y
Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000471558 |
Family | CE8 |
Protein Properties | Length: 119 Molecular Weight: 13522.3 Isoelectric Point: 7.4586 |
Chromosome | Chromosome/Scaffold: 020100247 Start: 543 End: 2223 |
Description | pectin methylesterase 31 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE8 | 2 | 66 | 4.1e-29 |
QDTLYLHYGKQYLKDCYVEGSVDFIFGNSSALLEHCHIHCKSAGFITAQSRKSSQETTGYVFLRC |
Full Sequence |
---|
Protein Sequence Length: 119 Download |
MQDTLYLHYG KQYLKDCYVE GSVDFIFGNS SALLEHCHIH CKSAGFITAQ SRKSSQETTG 60 YVFLRCFGPG SCPSKRVTWA RELVDEEADQ FLQHRFIDPD PGRPWLAQRM ALRIPYSA* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02432 | PLN02432 | 3.0e-20 | 2 | 66 | 67 | + putative pectinesterase | ||
pfam01095 | Pectinesterase | 3.0e-21 | 2 | 105 | 111 | + Pectinesterase. | ||
PLN02682 | PLN02682 | 5.0e-28 | 2 | 106 | 162 | + pectinesterase family protein | ||
PLN02773 | PLN02773 | 1.0e-71 | 2 | 118 | 175 | + pectinesterase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005618 | cell wall |
GO:0030599 | pectinesterase activity |
GO:0042545 | cell wall modification |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABN08265.1 | 0 | 2 | 118 | 142 | 316 | Pectinesterase [Medicago truncatula] |
RefSeq | NP_566842.1 | 7.00649e-45 | 2 | 118 | 143 | 317 | pectinesterase family protein [Arabidopsis thaliana] |
RefSeq | XP_002283941.1 | 8.40779e-45 | 2 | 118 | 142 | 316 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002305315.1 | 0 | 2 | 118 | 142 | 316 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002530008.1 | 0 | 2 | 118 | 142 | 316 | Pectinesterase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1gq8_A | 0.0000000000005 | 2 | 66 | 135 | 204 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 1xg2_A | 0.0000000001 | 2 | 66 | 131 | 200 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 2ntq_B | 0.00000008 | 2 | 57 | 153 | 217 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 2ntq_A | 0.00000008 | 2 | 57 | 153 | 217 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 2ntp_B | 0.00000008 | 2 | 57 | 153 | 217 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FQ365699 | 176 | 2 | 119 | 0 |
DV113912 | 176 | 2 | 119 | 0 |
HS558074 | 177 | 1 | 119 | 0 |
JZ000475 | 176 | 2 | 119 | 0 |
JZ000474 | 176 | 2 | 119 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |