| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000517816 |
| Family | GT1 |
| Protein Properties | Length: 152 Molecular Weight: 17145.7 Isoelectric Point: 7.5142 |
| Chromosome | Chromosome/Scaffold: 002919360 Start: 1926 End: 3069 |
| Description | UDP-glucosyl transferase 88A1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 15 | 127 | 5.5e-21 |
| GDSKRVGDKWDGKRFLWVVKKPPVDVKTKQLHGADNDFDLEGLLPEEFLDRTNDRGMVVKSWAPQAAVLKKESVCGFVTHCRPNSVLEAVVSGVPLIAWP LYAEQHLNRNNLV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 152 Download |
| MFEMERIILT DSTEGDSKRV GDKWDGKRFL WVVKKPPVDV KTKQLHGADN DFDLEGLLPE 60 EFLDRTNDRG MVVKSWAPQA AVLKKESVCG FVTHCRPNSV LEAVVSGVPL IAWPLYAEQH 120 LNRNNLVKVM EIATRVVERK EDGVRNVSTT R* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02534 | PLN02534 | 9.0e-24 | 55 | 136 | 82 | + UDP-glycosyltransferase | ||
| PLN02554 | PLN02554 | 4.0e-27 | 26 | 141 | 117 | + UDP-glycosyltransferase family protein | ||
| PLN02992 | PLN02992 | 2.0e-27 | 58 | 145 | 88 | + coniferyl-alcohol glucosyltransferase | ||
| PLN03004 | PLN03004 | 1.0e-33 | 20 | 138 | 119 | + UDP-glycosyltransferase | ||
| PLN00164 | PLN00164 | 5.0e-34 | 26 | 142 | 118 | + glucosyltransferase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABY73540.1 | 0 | 21 | 143 | 305 | 426 | glycosyltransferase UGT88A1 [Malus pumila] |
| GenBank | ACZ44838.1 | 0 | 21 | 143 | 305 | 426 | glycosyltransferase [Pyrus communis] |
| GenBank | ACZ44839.1 | 0 | 21 | 143 | 303 | 425 | glycosyltransferase [Malus x domestica] |
| GenBank | ACZ44840.1 | 0 | 21 | 143 | 305 | 426 | glycosyltransferase [Malus x domestica] |
| GenBank | ACZ44841.1 | 0 | 21 | 143 | 303 | 424 | glycosyltransferase [Malus x domestica] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 2e-25 | 27 | 135 | 298 | 405 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2vch_A | 2e-25 | 27 | 135 | 298 | 405 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2vce_A | 2e-25 | 27 | 135 | 298 | 405 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c9z_A | 2e-17 | 58 | 136 | 315 | 392 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c1z_A | 2e-17 | 58 | 136 | 315 | 392 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GO532340 | 119 | 25 | 143 | 0 |
| EB145911 | 119 | 25 | 143 | 0 |
| GO537278 | 123 | 21 | 143 | 0 |
| EB153019 | 123 | 21 | 143 | 0 |
| GO517438 | 123 | 21 | 143 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
