CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000589608
FamilyGT66
Protein PropertiesLength: 744 Molecular Weight: 83317.8 Isoelectric Point: 8.9508
ChromosomeChromosome/Scaffold: 004082149 Start: 24312 End: 28286
Descriptionstaurosporin and temperature sensitive 3-like b
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66476930
  LLIRVSILCLVYVLAFITRLFSVLRYESMIHEFDPYFNYRTTLYLTEKGFYEFWNWFDSESWYPLGRIIGGTLYPGLMVTAAIIYWALRFLSFAVHIREV
  CVLTAPFFASNTTLVAYFFGKEIWDTGAGLVAAALIAICPGYISRSVAGSYDNEGVAIFALLLTFYLFVKAVNTGSLAWALGSALGYFYMVSAWGGYIFI
  INLIPLYVLVLLITGRYSMRLYVAYNCTYILGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLMQVFYFLDYVKHLLSDSKMFQAFLRITVTCAVGVGGVAL
  GVGTASGYISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFVVMYGLTSMYFAGVMVRLILVATPAV
  CLISAIAVSATIKNLTQLARAKDKVSQTGSTKGTSSTKGSSKGSIDQSQPFQKNGALVLLFGAFYLLSKYATHCTWVTSEAYSSPSIVLAARGAHGNRVI
  FDDYREAYFWLRQNTPPDAKVMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSSDDINKFLWMVR
  IGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELT
Full Sequence
Protein Sequence     Length: 744     Download
MVGKTEPLNA TATTKTGQSP PLATSMSGLL GNFSFKTLKL KTKQQELLIR VSILCLVYVL    60
AFITRLFSVL RYESMIHEFD PYFNYRTTLY LTEKGFYEFW NWFDSESWYP LGRIIGGTLY    120
PGLMVTAAII YWALRFLSFA VHIREVCVLT APFFASNTTL VAYFFGKEIW DTGAGLVAAA    180
LIAICPGYIS RSVAGSYDNE GVAIFALLLT FYLFVKAVNT GSLAWALGSA LGYFYMVSAW    240
GGYIFIINLI PLYVLVLLIT GRYSMRLYVA YNCTYILGML LAMQIRFVGF QHVQSGEHMA    300
AMGVFFLMQV FYFLDYVKHL LSDSKMFQAF LRITVTCAVG VGGVALGVGT ASGYISPWTG    360
RFYSLLDPTY AKDHIPIIAS VSEHQPTAWS SFMFDFHILL FLFPAGLYFC FKRLSDATIF    420
VVMYGLTSMY FAGVMVRLIL VATPAVCLIS AIAVSATIKN LTQLARAKDK VSQTGSTKGT    480
SSTKGSSKGS IDQSQPFQKN GALVLLFGAF YLLSKYATHC TWVTSEAYSS PSIVLAARGA    540
HGNRVIFDDY REAYFWLRQN TPPDAKVMSW WDYGYQITAM GNRTVIVDNN TWNNTHIATV    600
GRAMSSYEDE AYDIMRSLDV DYVLVVFGGV TGYSSDDINK FLWMVRIGGG VFPVIKEPDY    660
LVNGEYRVDK GAAPKMLNCL MYKLSYYRFG ELTTEYGKPP GYDRARGVEI GNKDIKLEYL    720
EEAFTTSNWI VRIYKVKPPN NRW*                                           780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT34.0e-7376625284+
TIGR04154archaeo_STT34.0e-1551259230+
COG1287COG12872.0e-6349737724+
pfam02516STT35.0e-14049694663+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_174675.2017421734STT3B (staurosporin and temperature sensitive 3-like b); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002269119.1087431737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318345.104474322721predicted protein [Populus trichocarpa]
RefSeqXP_002329687.1027433721predicted protein [Populus trichocarpa]
RefSeqXP_002514508.10186816669oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A051773718238A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.0000055496656123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.0000055496656123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.0000055496656123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vgp_A0.000065486496113A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
4769
112134
141163
173195
202224
239261
268290
300322
329351
389411
418440
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0360633473186640
GO8701293234207420
GT0332323193606780
GO8695183263937180
GO869518147097220.47
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)