| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000631129 |
| Family | GH17 |
| Protein Properties | Length: 115 Molecular Weight: 11845.8 Isoelectric Point: 9.8372 |
| Chromosome | Chromosome/Scaffold: 012993181 Start: 1972 End: 2316 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 22 | 103 | 8.3e-27 |
| IGVNWGTTASHPLPPAKMVELLRSNNVTKVKLFDADPGVLGALSGSKLSVTVGIPNALLKFLNSSKKAAESWVHENVTRYVS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 115 Download |
| MPPNLCTLLF LLATTVSTCG AIGVNWGTTA SHPLPPAKMV ELLRSNNVTK VKLFDADPGV 60 LGALSGSKLS VTVGIPNALL KFLNSSKKAA ESWVHENVTR YVSNGGGGVG VKIE* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 9.0e-15 | 22 | 101 | 80 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI28434.1 | 2e-40 | 1 | 114 | 1 | 115 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_200656.2 | 7e-35 | 12 | 114 | 16 | 115 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002269108.1 | 1.99993e-41 | 21 | 114 | 25 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002313970.1 | 5e-40 | 18 | 112 | 18 | 112 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002515703.1 | 1e-38 | 18 | 112 | 4 | 98 | Glucan endo-1,3-beta-glucosidase, acidic isoform PR-O, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000002 | 22 | 101 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.00000001 | 22 | 98 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.00000001 | 22 | 98 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.00000001 | 22 | 98 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.00000001 | 22 | 98 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 7 | 29 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 21 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DY654043 | 112 | 2 | 112 | 0 |
| GW876821 | 113 | 1 | 112 | 3.9937e-43 |
| BY801665 | 103 | 12 | 114 | 9.99967e-42 |
| BY807881 | 103 | 12 | 114 | 3.00004e-41 |
| GO313904 | 92 | 21 | 112 | 4.99997e-41 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |