Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000745582 |
Family | GT8 |
Protein Properties | Length: 268 Molecular Weight: 30130.9 Isoelectric Point: 5.9817 |
Chromosome | Chromosome/Scaffold: 002065360 Start: 45 End: 1281 |
Description | glucosyl transferase family 8 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT8 | 44 | 232 | 1.7e-34 |
CDPSLIHADSEYLRGTIAAVHSVFKHASCPENTFFHFVASDSSAVDSHHLSRILKSTFPLINFRVYVFRESLVSHMISSSIRRALENPLNYARSYLADLL DPCVERVIYLDSDIVVVDDIQKLWEITLSGSRVIGALEYCHTNFTKYFSDEFWKDSELSKVFDRKRPWYFNTGVMVIDLDSEREEDLRT |
Full Sequence |
---|
Protein Sequence Length: 268 Download |
MLASLTGGMH ILHIAPFSNT VSSSYNSGCP VLLGSNDRAG KEVCDPSLIH ADSEYLRGTI 60 AAVHSVFKHA SCPENTFFHF VASDSSAVDS HHLSRILKST FPLINFRVYV FRESLVSHMI 120 SSSIRRALEN PLNYARSYLA DLLDPCVERV IYLDSDIVVV DDIQKLWEIT LSGSRVIGAL 180 EYCHTNFTKY FSDEFWKDSE LSKVFDRKRP WYFNTGVMVI DLDSEREEDL RTGFSSSVSV 240 GVRRRRGGDS PYPNNLGYGF WISDDFD* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG1442 | RfaJ | 3.0e-10 | 51 | 230 | 182 | + Lipopolysaccharide biosynthesis proteins, LPS:glycosyltransferases [Cell envelope biogenesis, outer membrane] | ||
cd06429 | GT8_like_1 | 7.0e-14 | 53 | 181 | 143 | + GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. | ||
cd00505 | Glyco_transf_8 | 2.0e-16 | 51 | 230 | 185 | + Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+. | ||
cd04194 | GT8_A4GalT_like | 4.0e-18 | 51 | 230 | 187 | + A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS. | ||
pfam01501 | Glyco_transf_8 | 2.0e-36 | 48 | 230 | 184 | + Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0016757 | transferase activity, transferring glycosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_189474.2 | 0 | 43 | 246 | 65 | 269 | GATL10 (Galacturonosyltransferase-like 10); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring hexosyl groups [Arabidopsis thaliana] |
RefSeq | NP_564983.1 | 0 | 44 | 245 | 77 | 282 | LGT8 (GLUCOSYL TRANSFERASE FAMILY 8); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana] |
RefSeq | XP_002271160.1 | 0 | 44 | 245 | 71 | 276 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002311853.1 | 0 | 6 | 245 | 36 | 279 | glycosyltransferase, CAZy family GT8 [Populus trichocarpa] |
RefSeq | XP_002517421.1 | 0 | 43 | 245 | 61 | 267 | transferase, transferring glycosyl groups, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1ss9_A | 0.0008 | 134 | 230 | 84 | 169 | A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc |
PDB | 1ga8_A | 0.002 | 134 | 230 | 84 | 169 | A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc |
PDB | 1g9r_A | 0.002 | 134 | 230 | 84 | 169 | A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EB119971 | 184 | 47 | 226 | 0 |
EB151466 | 177 | 25 | 195 | 0 |
EB151829 | 170 | 25 | 188 | 0 |
EB152395 | 164 | 25 | 182 | 0 |
GO504007 | 163 | 25 | 181 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|