CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000794968
FamilyGT65
Protein PropertiesLength: 451 Molecular Weight: 50891.4 Isoelectric Point: 7.6252
ChromosomeChromosome/Scaffold: 013737145 Start: 10377 End: 11729
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65832007.9e-33
  GLNNQKIAFARACLTAXFLNRTLLMPSLSASLFYKEVELLEPIPFDKVFQFNKFNSLCNGFVQLGEFTDVRNRTAAFELQKGSGRRWTPDRDMDQLKHHN
  EDPYSEYEVIRIVGRNPF
GT652023950
  WHDHWPVKDYAKIFECLVLVDEIMNEAEKVLSRIREMGAAQVKSQSESAQNGISPAENSLVQPVPYVAVHMRIEIDWMIHCKKLEQRSNITQICSSKEEI
  MERVGNIVGLKTPVVVYLAIADSLLHDPSILNGWKSGLIPFEKKKLGVEGNYKKFPYLIQSAIDYEVCLRADVFVGNSFSTFSNLIVLDRTQKL
Full Sequence
Protein Sequence     Length: 451     Download
MDVPPYCKNF RVLGCHLNSF ACKCVVLALT ALIIRAVLLP TFSISDGTEQ DNLVFISNLS    60
LSFGQKSGIR KDKFLEVPQI VWGLNNQKIA FARACLTAXF LNRTLLMPSL SASLFYKEVE    120
LLEPIPFDKV FQFNKFNSLC NGFVQLGEFT DVRNRTAAFE LQKGSGRRWT PDRDMDQLKH    180
HNEDPYSEYE VIRIVGRNPF LWHDHWPVKD YAKIFECLVL VDEIMNEAEK VLSRIREMGA    240
AQVKSQSESA QNGISPAENS LVQPVPYVAV HMRIEIDWMI HCKKLEQRSN ITQICSSKEE    300
IMERVGNIVG LKTPVVVYLA IADSLLHDPS ILNGWKSGLI PFEKKKLGVE GNYKKFPYLI    360
QSAIDYEVCL RADVFVGNSF STFSNLIVLD RTQKLIRTGV TSSCGVDVRW PSYAYNILGE    420
SNGPQRWMAN MSSSSLQPIS YGSNDISCQV *                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.0047410835+
cd11302O-FucT-10.0002266391147+
cd11299O-FucT_plant2.0e-1383392340+
cd11296O-FucT_like2.0e-22204392193+
pfam10250O-FucT9.0e-4183392341+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.3014481442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10214482427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.101004481347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.101004481347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.1014481446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.0002266391212344A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3zy5_A0.0002266391212344A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3zy4_A0.0002266391212344A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3zy3_B0.0002266391212344A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3zy3_A0.0002266391212344A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW5174702621884480
BU0433982112404500
DW5173972461884320
GO8579223081434490
GW440396234933260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny