| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000802026 |
| Family | GH27 |
| Protein Properties | Length: 93 Molecular Weight: 10451.8 Isoelectric Point: 5.6285 |
| Chromosome | Chromosome/Scaffold: 010819188 Start: 10427 End: 11423 |
| Description | alpha-galactosidase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH27 | 6 | 85 | 8.2e-23 |
| MGIDYLKYDNCNNDDSKPTFRYPVMTQALMKAGHPIFFSLCEWGDMHPTQWGAKEGNSCRTANDISDTWESMLSRADMNA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| MGKTRMGIDY LKYDNCNNDD SKPTFRYPVM TQALMKAGHP IFFSLCEWGD MHPTQWGAKE 60 GNSCRTANDI SDTWESMLSR ADMNAGNMNG IY* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02065 | Melibiase | 0.002 | 7 | 49 | 55 | + Melibiase. | ||
| PLN02229 | PLN02229 | 8.0e-27 | 7 | 84 | 78 | + alpha-galactosidase | ||
| PLN02808 | PLN02808 | 4.0e-33 | 7 | 84 | 78 | + alpha-galactosidase | ||
| PLN02692 | PLN02692 | 2.0e-46 | 7 | 84 | 78 | + alpha-galactosidase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU20569.1 | 2e-38 | 7 | 84 | 168 | 245 | unknown [Glycine max] |
| EMBL | CAN75822.1 | 5e-39 | 7 | 84 | 113 | 190 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002270791.1 | 9e-39 | 7 | 84 | 166 | 243 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002316426.1 | 5.99994e-41 | 7 | 84 | 127 | 204 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002513158.1 | 1e-39 | 7 | 84 | 170 | 247 | alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1uas_A | 1e-21 | 7 | 84 | 123 | 200 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
| PDB | 3lrl_A | 0.00000000007 | 8 | 71 | 143 | 211 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
| PDB | 3lrk_A | 0.00000000007 | 8 | 71 | 143 | 211 | A Chain A, Structure Of Alfa-Galactosidase (Mel1) From Saccharomyces Cerevisiae |
| PDB | 3a5v_A | 0.0000000002 | 5 | 72 | 120 | 192 | A Chain A, Crystal Structure Of Alpha-Galactosidase I From Mortierella Vinacea |
| PDB | 3lrm_D | 0.0000000006 | 8 | 71 | 143 | 211 | A Chain A, Structure Of Alfa-Galactosidase From Saccharomyces Cerevisiae With Raffinose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CX658862 | 78 | 7 | 84 | 3.99931e-42 |
| BE239962 | 78 | 7 | 84 | 6.00036e-42 |
| CA858922 | 78 | 7 | 84 | 9.99967e-42 |
| BQ124467 | 78 | 7 | 84 | 1.99993e-41 |
| BQ123072 | 78 | 7 | 84 | 1.99993e-41 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
