CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000805281
FamilyGH1
Protein PropertiesLength: 315 Molecular Weight: 35434.3 Isoelectric Point: 6.6751
ChromosomeChromosome/Scaffold: 007969216 Start: 4838 End: 7044
Descriptionbeta glucosidase 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1403060
  RSSFEPGFIFGTGSASYQYEGAVKEDGRGPSIWDTFTHKHPEKIADGSNGDVAIDQYHRYKEDVGIMKDMNLDAYRLSISWSRLLPNGTLSGGVNRKGID
  YYNNLINELLRNGLKPFVTLFHWDVPQALEDEYGGFLSPRIVXHFKDYAELCYKEFGDRVKHWFTVNEPYTFSSMGYAVGTLAPGRCSSWQNLNCTGGDS
  AIEPYLVTHHILLAHGAAVELYRNRYQASQKGLIGITLVSYWFEPASESKQDKDAALRSLDFMFGWQ
Full Sequence
Protein Sequence     Length: 315     Download
MAMKYSRXLL FGVLLLIGFA LTNGKATNTD PPVHCEFLNR SSFEPGFIFG TGSASYQYEG    60
AVKEDGRGPS IWDTFTHKHP EKIADGSNGD VAIDQYHRYK EDVGIMKDMN LDAYRLSISW    120
SRLLPNGTLS GGVNRKGIDY YNNLINELLR NGLKPFVTLF HWDVPQALED EYGGFLSPRI    180
VXHFKDYAEL CYKEFGDRVK HWFTVNEPYT FSSMGYAVGT LAPGRCSSWQ NLNCTGGDSA    240
IEPYLVTHHI LLAHGAAVEL YRNRYQASQK GLIGITLVSY WFEPASESKQ DKDAALRSLD    300
FMFGWQVFGP FNKX*                                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028142.0e-9440311276+
PLN02998PLN029989.0e-9539311277+
PLN02849PLN028491.0e-9639305267+
TIGR03356BGL1.0e-11046305260+
pfam00232Glyco_hydro_14.0e-11642305265+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAA91166.10143051295beta-glucosidase [Prunus avium]
GenBankAAA93234.202230521307amygdalin hydrolase isoform AH I precursor [Prunus serotina]
GenBankAAF34650.101330510303AF221526_1 prunasin hydrolase isoform PHA precursor [Prunus serotina]
GenBankAAL07489.10293053282AF414606_1 amygdalin hydrolase isoform AH I precursor [Prunus serotina]
GenBankAAL35324.101330510306AF411131_1 prunasin hydrolase isoform PH C precursor [Prunus serotina]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A03830514281A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_B03030526296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_A03030526296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_B03030526296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_A03030526296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW86969329212890
CB893105270383070
FE968273270363050
GO500353198822790
FE710071275313050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00058.11
Carica papayaevm.model.supercontig_84.113
Citrus sinensisorange1.1g046612m
Cucumis sativusCucsa.143120.2Cucsa.143180.1Cucsa.143170.1
Glycine maxGlyma12g11291.1
Gossypium raimondiiGorai.008G271500.4
Malus domesticaMDP0000128297MDP0000205601.32.295MDP0000205601.32.295MDP0000194075
Manihot esculentacassava4.1_028771m.42.267cassava4.1_028771m.42.267cassava4.1_028884m
Mimulus guttatusmgv1a023615m.11.304mgv1a023615m.11.304mgv1a010574mmgv1a006902m
Oryza sativaLOC_Os04g39814.1LOC_Os09g31430.2
Panicum virgatumPavirv00057702mPavirv00054681mPavirv00009210mPavirv00010617m
Picea abiesMA_10429137g0030MA_10426536g0010MA_9186460g0010MA_101776g0010
Vitis viniferaGSVIVT01032019001GSVIVT01032142001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny