| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000811246 |
| Family | GT1 |
| Protein Properties | Length: 149 Molecular Weight: 16649.8 Isoelectric Point: 6.5035 |
| Chromosome | Chromosome/Scaffold: 021743234 Start: 16318 End: 16764 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 7 | 114 | 2e-24 |
| WCKQLKVLCHSSVGGFWSHCGWNSTLEAVFAGVPMLTSPLFPDQIPNNWQIVEGWKIGKRVKSEVHDEKLMTREEVAELVKRFMDPESSDGXEMRRRAKE LGDLCHRA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 149 Download |
| MGLVVPWCKQ LKVLCHSSVG GFWSHCGWNS TLEAVFAGVP MLTSPLFPDQ IPNNWQIVEG 60 WKIGKRVKSE VHDEKLMTRE EVAELVKRFM DPESSDGXEM RRRAKELGDL CHRAIAKGGS 120 SDTNLDDFIR DIGKATCNLQ TETQVPYP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02555 | PLN02555 | 2.0e-28 | 2 | 133 | 133 | + limonoid glucosyltransferase | ||
| PLN02554 | PLN02554 | 2.0e-28 | 2 | 134 | 139 | + UDP-glycosyltransferase family protein | ||
| PLN02173 | PLN02173 | 6.0e-29 | 3 | 132 | 130 | + UDP-glucosyl transferase family protein | ||
| PLN02534 | PLN02534 | 2.0e-32 | 2 | 134 | 142 | + UDP-glycosyltransferase | ||
| PLN02448 | PLN02448 | 8.0e-85 | 1 | 132 | 132 | + UDP-glycosyltransferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI15890.1 | 0 | 2 | 134 | 231 | 363 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002274420.1 | 0 | 2 | 134 | 309 | 441 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002274566.1 | 0 | 2 | 135 | 315 | 448 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002298503.1 | 0 | 1 | 132 | 322 | 453 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002313223.1 | 0 | 2 | 132 | 324 | 454 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 7e-24 | 2 | 132 | 355 | 477 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2acv_B | 5e-21 | 2 | 132 | 334 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acv_A | 5e-21 | 2 | 132 | 334 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acw_B | 5e-21 | 2 | 132 | 334 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acw_A | 5e-21 | 2 | 132 | 334 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CV269394 | 132 | 1 | 132 | 0 |
| CV243556 | 132 | 1 | 132 | 0 |
| DN490997 | 132 | 1 | 132 | 0 |
| DT487275 | 132 | 1 | 132 | 0 |
| CB342966 | 133 | 2 | 134 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
