Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000895000 |
Family | GT1 |
Protein Properties | Length: 125 Molecular Weight: 13438.4 Isoelectric Point: 7.5099 |
Chromosome | Chromosome/Scaffold: 008539333 Start: 4740 End: 5478 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 2 | 95 | 3.2e-29 |
VHHGGAGTTAAGLKAACPTTIIPFFGDQPFWGERVHARGVGPAPIPVEEFSLDKLVDAIRFMLDPKVKECAIEIAKAMDNEDGVRGAVKAFHRH |
Full Sequence |
---|
Protein Sequence Length: 125 Download |
MVHHGGAGTT AAGLKAACPT TIIPFFGDQP FWGERVHARG VGPAPIPVEE FSLDKLVDAI 60 RFMLDPKVKE CAIEIAKAMD NEDGVRGAVK AFHRHFPCNR SDDGEPDQSL PARKGLLSIR 120 RCFG* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG1819 | COG1819 | 4.0e-10 | 2 | 94 | 94 | + Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] |
cd03784 | GT1_Gtf_like | 4.0e-23 | 1 | 95 | 95 | + This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACD03256.1 | 0 | 1 | 124 | 39 | 163 | UDP-glycosyltransferase [Avena strigosa] |
DDBJ | BAC22617.1 | 0 | 1 | 124 | 482 | 600 | UDP-glucose:sterol 3-O-glucosyltransferase [Panax ginseng] |
EMBL | CBI37267.1 | 0 | 1 | 124 | 494 | 613 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002265023.1 | 0 | 1 | 124 | 541 | 660 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002512608.1 | 0 | 1 | 124 | 473 | 594 | transferase, transferring glycosyl groups, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3h4t_A | 0.00000002 | 1 | 114 | 288 | 392 | A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus |
PDB | 3h4i_A | 0.00000002 | 1 | 114 | 288 | 392 | A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products |
PDB | 1iir_A | 0.00000009 | 1 | 82 | 305 | 385 | A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb |
PDB | 1rrv_B | 0.00002 | 1 | 76 | 306 | 380 | A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin. |
PDB | 1rrv_A | 0.00002 | 1 | 76 | 306 | 380 | A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin. |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GE495491 | 124 | 1 | 124 | 0 |
GE502366 | 124 | 1 | 124 | 0 |
FG162240 | 124 | 1 | 124 | 0 |
GR080777 | 124 | 1 | 124 | 0 |
CF981370 | 124 | 1 | 124 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|