| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000911142 |
| Family | GH1 |
| Protein Properties | Length: 132 Molecular Weight: 15124.2 Isoelectric Point: 9.5481 |
| Chromosome | Chromosome/Scaffold: 001332392 Start: 17984 End: 18570 |
| Description | beta glucosidase 43 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 13 | 114 | 4.3e-29 |
| SSTEPYIAAHHIILAHATAVKLYKERYQVEQNGEIRIVLATKYFKPYSNSQEDQAAAKRLFDFYLGWFMGPLVFGNYPQSMRELVKERLPTFSAEEKSLV RT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 132 Download |
| MVAVGPCNFG GNSSTEPYIA AHHIILAHAT AVKLYKERYQ VEQNGEIRIV LATKYFKPYS 60 NSQEDQAAAK RLFDFYLGWF MGPLVFGNYP QSMRELVKER LPTFSAEEKS LVRTFEQGFW 120 SSWSRYPTKT R* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 5.0e-9 | 44 | 96 | 53 | + beta-galactosidase. | ||
| PLN02998 | PLN02998 | 7.0e-18 | 11 | 113 | 103 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-18 | 10 | 113 | 107 | + Glycosyl hydrolase family 1. | ||
| PLN02814 | PLN02814 | 9.0e-21 | 11 | 113 | 103 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 5.0e-24 | 11 | 113 | 103 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAX95520.1 | 9e-37 | 7 | 113 | 268 | 374 | Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica Group] |
| GenBank | ABC55716.1 | 4e-37 | 7 | 113 | 211 | 317 | beta-mannosidase 3 [Oncidium Gower Ramsey] |
| GenBank | EEC76023.1 | 6e-37 | 7 | 113 | 233 | 339 | hypothetical protein OsI_13187 [Oryza sativa Indica Group] |
| RefSeq | NP_001051014.1 | 6e-37 | 7 | 113 | 233 | 339 | Os03g0703100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002511218.1 | 6e-37 | 10 | 113 | 247 | 350 | beta-glucosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3scw_B | 1e-34 | 7 | 113 | 203 | 309 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scw_A | 1e-34 | 7 | 113 | 203 | 309 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scq_B | 1e-34 | 7 | 113 | 203 | 309 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scq_A | 1e-34 | 7 | 113 | 203 | 309 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scp_B | 1e-34 | 7 | 113 | 203 | 309 | A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DY255343 | 110 | 3 | 112 | 9e-34 |
| BU896443 | 106 | 11 | 116 | 2e-32 |
| CK046240 | 107 | 7 | 113 | 2e-30 |
| CK007513 | 107 | 7 | 113 | 5e-30 |
| CK047280 | 107 | 7 | 113 | 1e-29 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Malus domestica | MDP0000128558 | MDP0000318790 | MDP0000199627 | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |