Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000921848 |
Family | GH35 |
Protein Properties | Length: 95 Molecular Weight: 10760.5 Isoelectric Point: 9.6041 |
Chromosome | Chromosome/Scaffold: 009258493 Start: 6780 End: 7377 |
Description | beta-galactosidase 17 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 16 | 93 | 1.9e-26 |
KDSQPFQIIGGDLHYFPVLPKYWEDRLLRAKTLGLNTIQSYAPRNQHEPRAGTLDFDGIMDLVALLKLSQKLGILVML |
Full Sequence |
---|
Protein Sequence Length: 95 Download |
MPESLKFQRT SSGNWKDSQP FQIIGGDLHY FPVLPKYWED RLLRAKTLGL NTIQSYAPRN 60 QHEPRAGTLD FDGIMDLVAL LKLSQKLGIL VMLM* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03059 | PLN03059 | 5.0e-11 | 23 | 93 | 71 | + beta-galactosidase; Provisional | ||
COG1874 | LacA | 3.0e-12 | 17 | 93 | 78 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam01301 | Glyco_hydro_35 | 3.0e-30 | 15 | 93 | 79 | + Glycosyl hydrolases family 35. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD55646.1 | 3e-29 | 4 | 93 | 60 | 149 | AC008017_19 Similar to acid beta-galactosidase [Arabidopsis thaliana] |
EMBL | CBI35958.1 | 4e-33 | 6 | 93 | 74 | 161 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_565051.1 | 3e-29 | 4 | 93 | 60 | 149 | BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana] |
RefSeq | XP_002280228.1 | 4e-33 | 6 | 93 | 50 | 137 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002527397.1 | 2e-30 | 15 | 93 | 63 | 141 | beta-galactosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3thd_D | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_C | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_B | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_A | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thc_D | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BQ403618 | 88 | 6 | 93 | 2e-36 |
CB006830 | 88 | 6 | 93 | 7e-36 |
ES841523 | 88 | 6 | 93 | 2e-35 |
JG858781 | 88 | 6 | 93 | 4e-35 |
FQ360436 | 88 | 6 | 93 | 4e-35 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|