| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000921848 |
| Family | GH35 |
| Protein Properties | Length: 95 Molecular Weight: 10760.5 Isoelectric Point: 9.6041 |
| Chromosome | Chromosome/Scaffold: 009258493 Start: 6780 End: 7377 |
| Description | beta-galactosidase 17 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH35 | 16 | 93 | 1.9e-26 |
| KDSQPFQIIGGDLHYFPVLPKYWEDRLLRAKTLGLNTIQSYAPRNQHEPRAGTLDFDGIMDLVALLKLSQKLGILVML | |||
| Full Sequence |
|---|
| Protein Sequence Length: 95 Download |
| MPESLKFQRT SSGNWKDSQP FQIIGGDLHY FPVLPKYWED RLLRAKTLGL NTIQSYAPRN 60 QHEPRAGTLD FDGIMDLVAL LKLSQKLGIL VMLM* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03059 | PLN03059 | 5.0e-11 | 23 | 93 | 71 | + beta-galactosidase; Provisional | ||
| COG1874 | LacA | 3.0e-12 | 17 | 93 | 78 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 3.0e-30 | 15 | 93 | 79 | + Glycosyl hydrolases family 35. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAD55646.1 | 3e-29 | 4 | 93 | 60 | 149 | AC008017_19 Similar to acid beta-galactosidase [Arabidopsis thaliana] |
| EMBL | CBI35958.1 | 4e-33 | 6 | 93 | 74 | 161 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_565051.1 | 3e-29 | 4 | 93 | 60 | 149 | BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana] |
| RefSeq | XP_002280228.1 | 4e-33 | 6 | 93 | 50 | 137 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002527397.1 | 2e-30 | 15 | 93 | 63 | 141 | beta-galactosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3thd_D | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thd_C | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thd_B | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thd_A | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 3thc_D | 1e-16 | 16 | 93 | 20 | 97 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BQ403618 | 88 | 6 | 93 | 2e-36 |
| CB006830 | 88 | 6 | 93 | 7e-36 |
| ES841523 | 88 | 6 | 93 | 2e-35 |
| JG858781 | 88 | 6 | 93 | 4e-35 |
| FQ360436 | 88 | 6 | 93 | 4e-35 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |