Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000935763 |
Family | CE8 |
Protein Properties | Length: 116 Molecular Weight: 13148.9 Isoelectric Point: 8.1106 |
Chromosome | Chromosome/Scaffold: 002208306 Start: 1680 End: 2942 |
Description | pectin methylesterase 31 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE8 | 5 | 95 | 1.6e-29 |
CVITGNGGTSYAYLGRPWGPFGRVVFAYTFMDGCIRHVGWNNWGKTENERSACFYEYRCFGPGSCPSKRVTWARELVDEEADQFLQHRFID |
Full Sequence |
---|
Protein Sequence Length: 116 Download |
MCPGCVITGN GGTSYAYLGR PWGPFGRVVF AYTFMDGCIR HVGWNNWGKT ENERSACFYE 60 YRCFGPGSCP SKRVTWAREL VDEEADQFLQ HRFIDPDPGR PWLAQRMALR IPYSA* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02480 | PLN02480 | 5.0e-22 | 12 | 103 | 95 | + Probable pectinesterase | ||
PLN02665 | PLN02665 | 4.0e-25 | 5 | 103 | 99 | + pectinesterase family protein | ||
PLN02682 | PLN02682 | 3.0e-30 | 5 | 103 | 99 | + pectinesterase family protein | ||
PLN02432 | PLN02432 | 1.0e-31 | 4 | 103 | 100 | + putative pectinesterase | ||
PLN02773 | PLN02773 | 4.0e-76 | 5 | 115 | 111 | + pectinesterase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005618 | cell wall |
GO:0030599 | pectinesterase activity |
GO:0042545 | cell wall modification |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABN08265.1 | 0 | 5 | 115 | 206 | 316 | Pectinesterase [Medicago truncatula] |
RefSeq | NP_566842.1 | 0 | 5 | 115 | 207 | 317 | pectinesterase family protein [Arabidopsis thaliana] |
RefSeq | XP_002283941.1 | 0 | 5 | 115 | 206 | 316 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002305315.1 | 0 | 5 | 115 | 206 | 316 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002530008.1 | 0 | 5 | 115 | 206 | 316 | Pectinesterase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1xg2_A | 0.0000006 | 17 | 107 | 218 | 297 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 1gq8_A | 0.00005 | 17 | 114 | 222 | 316 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 1qjv_B | 0.0002 | 18 | 94 | 241 | 334 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
PDB | 1qjv_A | 0.0002 | 18 | 94 | 241 | 334 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
PDB | 2nt9_B | 0.0002 | 18 | 94 | 241 | 334 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DY256594 | 112 | 5 | 116 | 0 |
CN900594 | 112 | 5 | 116 | 0 |
GO565285 | 112 | 5 | 116 | 0 |
CV048226 | 112 | 5 | 116 | 0 |
CB822961 | 112 | 5 | 116 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|