| Basic Information | |
|---|---|
| Species | Medicago truncatula |
| Cazyme ID | Medtr7g102570.1 |
| Family | CE8 |
| Protein Properties | Length: 120 Molecular Weight: 13230.2 Isoelectric Point: 9.6588 |
| Chromosome | Chromosome/Scaffold: 7 Start: 32866927 End: 32867402 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 3 | 104 | 2.5e-32 |
| QKCIINSIAKPEWGGNGGYITAQQRESLKNETGLSFVNCRIDGTGKVLLGRPWRPFATVIFSTTYMSNVVAAQGWTDKMNSMNRTFFFGEYNCSGPGAIK TN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 120 Download |
| MHQKCIINSI AKPEWGGNGG YITAQQRESL KNETGLSFVN CRIDGTGKVL LGRPWRPFAT 60 VIFSTTYMSN VVAAQGWTDK MNSMNRTFFF GEYNCSGPGA IKTNTLMESN SNIMKLLHT* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02671 | PLN02671 | 2.0e-25 | 1 | 100 | 101 | + pectinesterase | ||
| PLN02665 | PLN02665 | 5.0e-26 | 7 | 100 | 96 | + pectinesterase family protein | ||
| PLN02682 | PLN02682 | 1.0e-27 | 1 | 100 | 101 | + pectinesterase family protein | ||
| PLN02304 | PLN02304 | 1.0e-29 | 1 | 100 | 104 | + probable pectinesterase | ||
| PLN02432 | PLN02432 | 2.0e-30 | 1 | 103 | 104 | + putative pectinesterase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAO22722.1 | 7e-27 | 1 | 100 | 253 | 353 | putative pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | NP_181209.1 | 6e-27 | 1 | 100 | 253 | 353 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002264941.1 | 5e-28 | 1 | 103 | 177 | 280 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002326223.1 | 4e-28 | 1 | 100 | 181 | 281 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002519425.1 | 1e-31 | 1 | 100 | 235 | 335 | Pectinesterase PPE8B precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0.00001 | 3 | 100 | 168 | 273 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.00001 | 1 | 100 | 162 | 269 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BP039949 | 107 | 1 | 106 | 2e-31 |
| GT660695 | 101 | 1 | 100 | 6e-30 |
| EX937438 | 107 | 1 | 103 | 1e-26 |
| AU304989 | 103 | 1 | 100 | 3e-26 |
| FP039884 | 110 | 1 | 106 | 1e-25 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |