| Basic Information | |
|---|---|
| Species | Medicago truncatula |
| Cazyme ID | Medtr7g102580.1 |
| Family | CE8 |
| Protein Properties | Length: 154 Molecular Weight: 17001.1 Isoelectric Point: 8.6029 |
| Chromosome | Chromosome/Scaffold: 7 Start: 32867561 End: 32868594 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 70 | 153 | 1.6e-29 |
| STGTFDSYSFGVFASEFIAYNVSFKNTAPLANPREKKKQAVALRVNGDQAAFYGCGFYSGQDQGRHYFKECFIQGSIDFIFGNG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 154 Download |
| MNLIGPQDYV SLLMTSIKGR INHMHKGNCD ETKWDSRLIS KYNVTLVFTV DSKGCGNFTK 60 VQEAVNNGNS TGTFDSYSFG VFASEFIAYN VSFKNTAPLA NPREKKKQAV ALRVNGDQAA 120 FYGCGFYSGQ DQGRHYFKEC FIQGSIDFIF GNG* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02480 | PLN02480 | 5.0e-24 | 27 | 153 | 179 | + Probable pectinesterase | ||
| PLN02665 | PLN02665 | 2.0e-29 | 72 | 153 | 87 | + pectinesterase family protein | ||
| PLN02634 | PLN02634 | 3.0e-30 | 67 | 153 | 92 | + probable pectinesterase | ||
| PLN02682 | PLN02682 | 2.0e-35 | 67 | 153 | 92 | + pectinesterase family protein | ||
| PLN02304 | PLN02304 | 4.0e-36 | 43 | 152 | 164 | + probable pectinesterase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAO22722.1 | 4e-37 | 33 | 153 | 76 | 250 | putative pectinesterase family protein [Arabidopsis thaliana] |
| EMBL | CBI30191.1 | 7e-40 | 29 | 153 | 86 | 264 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_181209.1 | 3e-38 | 33 | 153 | 76 | 250 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002326223.1 | 2e-38 | 33 | 153 | 3 | 178 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002459865.1 | 6e-34 | 30 | 152 | 83 | 259 | hypothetical protein SORBIDRAFT_02g012560 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0.0000000000003 | 59 | 153 | 69 | 163 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.0000001 | 59 | 153 | 65 | 159 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_B | 0.000008 | 66 | 153 | 78 | 181 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_A | 0.000008 | 66 | 153 | 78 | 181 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntp_B | 0.000008 | 66 | 153 | 78 | 181 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EE641923 | 140 | 29 | 153 | 2.99878e-43 |
| DY951481 | 179 | 29 | 153 | 2e-39 |
| DY916896 | 179 | 29 | 153 | 2e-39 |
| DY946829 | 179 | 29 | 153 | 4e-39 |
| EE643660 | 179 | 29 | 153 | 2e-38 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Arabidopsis lyrata | 870009.32.214 | 870009.32.214 | |||
| Mimulus guttatus | mgv1a024611m | ||||
| Physcomitrella patens | Pp1s261_56V6.1 | ||||
| Picea abies | MA_272638g0010 | MA_32575g0010 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |