Basic Information | |
---|---|
Species | Medicago truncatula |
Cazyme ID | Medtr8g085440.1 |
Family | CBM43 |
Protein Properties | Length: 117 Molecular Weight: 12338.1 Isoelectric Point: 7.7724 |
Chromosome | Chromosome/Scaffold: 8 Start: 23360515 End: 23361069 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 32 | 113 | 1.1e-34 |
WCQVRSSATGPALQNALNYACSNGADCGPIQPGGSCFNPNTLQSHASYAFDSFYQSKGQNPSACNFGGLATIAVTDPSYGSC |
Full Sequence |
---|
Protein Sequence Length: 117 Download |
MASPKLHSVM IMLTIFIAMI LMNVMIVESK TWCQVRSSAT GPALQNALNY ACSNGADCGP 60 IQPGGSCFNP NTLQSHASYA FDSFYQSKGQ NPSACNFGGL ATIAVTDPSY GSCRYP* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-23 | 31 | 102 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-42 | 31 | 115 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU17645.1 | 1e-35 | 1 | 116 | 1 | 114 | unknown [Glycine max] |
RefSeq | NP_192648.2 | 4e-30 | 5 | 115 | 3 | 114 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_193096.5 | 1e-30 | 32 | 116 | 61 | 145 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002267551.1 | 5e-30 | 31 | 116 | 49 | 134 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002518089.1 | 6e-34 | 15 | 116 | 8 | 111 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 6e-25 | 31 | 116 | 12 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |