Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00002278m |
Family | GH13 |
Protein Properties | Length: 246 Molecular Weight: 28299.8 Isoelectric Point: 5.4249 |
Chromosome | Chromosome/Scaffold: 0102605 Start: 401 End: 3620 |
Description | starch branching enzyme 2.2 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH13 | 1 | 235 | 1.4e-26 |
YHVTNFFAPSSRFGTPEDLKSLIDRAHELGLLVLMDVVHSHASSNTLDGLNGFDGTDTHYFHSGPRGHHWMWDSRLFNYGNWEVLRFLLSNARWWLEEYK FDGFRFDGVTSMMYTHHGLQVSFTGNFNEYFGFATDVDAVVYLMLVNDLIHGLYPEAVSIGEDVSGMPTFAIPVHDGGVGFDYRLHMAVADKWIELMKQS DESWKMGDIVHTLTNRRWLEKCVTYSESHDQALVG |
Full Sequence |
---|
Protein Sequence Length: 246 Download |
YHVTNFFAPS SRFGTPEDLK SLIDRAHELG LLVLMDVVHS HASSNTLDGL NGFDGTDTHY 60 FHSGPRGHHW MWDSRLFNYG NWEVLRFLLS NARWWLEEYK FDGFRFDGVT SMMYTHHGLQ 120 VSFTGNFNEY FGFATDVDAV VYLMLVNDLI HGLYPEAVSI GEDVSGMPTF AIPVHDGGVG 180 FDYRLHMAVA DKWIELMKQS DESWKMGDIV HTLTNRRWLE KCVTYSESHD QALVGDKTIA 240 FWLMDK |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0296 | GlgB | 3.0e-58 | 1 | 245 | 247 | + 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | ||
PLN03244 | PLN03244 | 1.0e-74 | 3 | 240 | 240 | + alpha-amylase; Provisional | ||
PLN02960 | PLN02960 | 8.0e-84 | 1 | 240 | 242 | + alpha-amylase | ||
cd11321 | AmyAc_bac_euk_BE | 3.0e-173 | 1 | 246 | 247 | + Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes. Branching enzymes (BEs) catalyze the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage yielding a non-reducing end oligosaccharide chain, and subsequent attachment to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. This group includes bacterial and eukaryotic proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. | ||
PLN02447 | PLN02447 | 0 | 1 | 246 | 247 | + 1,4-alpha-glucan-branching enzyme |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003824 | catalytic activity |
GO:0005975 | carbohydrate metabolic process |
GO:0043169 | cation binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB33385.1 | 0 | 1 | 246 | 280 | 525 | branching enzyme II BEII [Zea mays, cultivar B73, endosperms, Peptide, 738 aa] |
GenBank | AAC33764.1 | 0 | 1 | 246 | 341 | 586 | starch branching enzyme IIb [Zea mays] |
GenBank | ACN30754.1 | 0 | 1 | 246 | 14 | 259 | unknown [Zea mays] |
RefSeq | NP_001105316.1 | 0 | 1 | 246 | 341 | 586 | amylose extender1 precursor [Zea mays] |
RefSeq | XP_002453926.1 | 0 | 1 | 246 | 345 | 590 | hypothetical protein SORBIDRAFT_04g021540 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3amk_A | 0 | 1 | 246 | 235 | 484 | A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L |
PDB | 3vu2_B | 0 | 1 | 246 | 235 | 484 | A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L |
PDB | 3vu2_A | 0 | 1 | 246 | 235 | 484 | A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L |
PDB | 3aml_A | 0 | 1 | 246 | 235 | 484 | A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L |
PDB | 3k1d_A | 1e-28 | 1 | 188 | 297 | 481 | A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
starch biosynthesis | RXN-7710 | EC-2.4.1.18 | 1,4-α-glucan branching enzyme |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EB403138 | 246 | 1 | 246 | 0 |
CO461672 | 244 | 3 | 246 | 0 |
GH205554 | 246 | 1 | 246 | 0 |
CD444875 | 237 | 10 | 246 | 0 |
FL732486 | 238 | 8 | 245 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|