Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00002759m |
Family | CBM43 |
Protein Properties | Length: 144 Molecular Weight: 15472.4 Isoelectric Point: 4.2676 |
Chromosome | Chromosome/Scaffold: 0338611 Start: 603 End: 1322 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 58 | 141 | 3.9e-33 |
WCVPKPGADEMMLQENIDFACGQEGVDCAAIRPGGVCYEPDTLQGHAAYAMNLYFQSNGQHVFDCDFGQTAVLTTADPSYGGCK |
Full Sequence |
---|
Protein Sequence Length: 144 Download |
SIFSLFDENL KPGPVSERNF GLFRGDMTPV YDAGIFTAPE TVVPVSTKVT PAAGRRQWCV 60 PKPGADEMML QENIDFACGQ EGVDCAAIRP GGVCYEPDTL QGHAAYAMNL YFQSNGQHVF 120 DCDFGQTAVL TTADPSYGGC KFM* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00332 | Glyco_hydro_17 | 9.0e-9 | 2 | 32 | 31 | + Glycosyl hydrolases family 17. | ||
pfam07983 | X8 | 1.0e-21 | 57 | 129 | 82 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 9.0e-43 | 57 | 142 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAH92875.1 | 0 | 1 | 142 | 9 | 157 | Os04g0681950 [Oryza sativa Japonica Group] |
GenBank | EEC78268.1 | 0 | 1 | 142 | 763 | 911 | hypothetical protein OsI_17962 [Oryza sativa Indica Group] |
GenBank | EEE61922.1 | 0 | 1 | 142 | 743 | 891 | hypothetical protein OsJ_16662 [Oryza sativa Japonica Group] |
RefSeq | NP_001151529.1 | 0 | 1 | 143 | 312 | 450 | LOC100285163 [Zea mays] |
RefSeq | XP_002448791.1 | 0 | 1 | 143 | 315 | 464 | hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-32 | 57 | 142 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
PDB | 1ghs_B | 0.0006 | 2 | 32 | 273 | 303 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 1ghs_A | 0.0006 | 2 | 32 | 273 | 303 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 4gzj_A | 0.003 | 2 | 31 | 281 | 310 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 4gzi_A | 0.003 | 2 | 31 | 281 | 310 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CA103690 | 151 | 1 | 144 | 0 |
DR796896 | 134 | 11 | 144 | 0 |
EB404450 | 132 | 13 | 144 | 0 |
FL454454 | 125 | 20 | 144 | 0 |
CI276177 | 146 | 8 | 144 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|