y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00003354m
FamilyGT29
Protein PropertiesLength: 353 Molecular Weight: 39562 Isoelectric Point: 8.8786
ChromosomeChromosome/Scaffold: 0314327 Start: 7 End: 1065
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291213310
  PGRIPSCAVVGNSGILLRANHGALIDSHDAVFRLNNARIAGYAAHVGSKTNFSFINSNVLHLCARRPGCFCHPYGHGVPILLYICQATHFLDIAACNTTS
  SSRHGSPISVTDARLDVLCSRIVKYYSLRRFVAETGRAAEDWDRAHDAAMFHYSSGMQAIMVAVGVCDRVSVFGFGKSSDAKHHYHSNQKAELDLHDYEA
  EYAFYHDLAEH
Full Sequence
Protein Sequence     Length: 353     Download
ARLNATLLRL AAVDPSEAPL RRDVDDLLEG RLPVSAARDR ARAWRRDRLL HPLHLHHHRF    60
PLPRRGRYPD EDHDTLLHPL PRHDQQLHID PALRRALRSW HRLRRYDPAV LGSLPSLLSL    120
PGRIPSCAVV GNSGILLRAN HGALIDSHDA VFRLNNARIA GYAAHVGSKT NFSFINSNVL    180
HLCARRPGCF CHPYGHGVPI LLYICQATHF LDIAACNTTS SSRHGSPISV TDARLDVLCS    240
RIVKYYSLRR FVAETGRAAE DWDRAHDAAM FHYSSGMQAI MVAVGVCDRV SVFGFGKSSD    300
AKHHYHSNQK AELDLHDYEA EYAFYHDLAE HPQVVPFLKD AGFAVPPVVF YH*           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_292.0e-29126331223+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY76560.10235247393hypothetical protein OsI_04506 [Oryza sativa Indica Group]
RefSeqNP_001044863.10235247393Os01g0858900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151877.10135245394sialyltransferase-like protein [Zea mays]
RefSeqXP_002456665.10135247396hypothetical protein SORBIDRAFT_03g040480 [Sorghum bicolor]
RefSeqXP_002523786.10335296434sialyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.000000000000023830925262A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A
PDB2wnb_A0.000000000000023830925262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.000000000000073830925262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HX1306402301233520
GD0192372301083370
DR9397892311233530
CN9480462181233400
GD019237293243520.001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi5g15097.1Bradi4g42490.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Fragaria vescamrna22044.1-v1.0-hybrid
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.004G009500.1Gorai.009G086400.1Gorai.001G121600.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Phaseolus vulgarisPhvul.011G093000.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny