Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00003693m |
Family | AA2 |
Protein Properties | Length: 208 Molecular Weight: 22010.5 Isoelectric Point: 4.7854 |
Chromosome | Chromosome/Scaffold: 0318923 Start: 560 End: 1414 |
Description | Peroxidase family protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 3 | 160 | 1.9e-24 |
TATDASNNLPSPLSNATELVGNFTRKGLTAEDMVVLSGAHTVGRSHCSSFTNRLYGFSNASDVDPAISSAYAFLLRSICPSNSSQFVPNTTTDMDLITPA VLDNKYYLGLANNLGLFTSDQALLTNSTLKKSVDEFVKSESRWKSKFAKAMVKMGNIE |
Full Sequence |
---|
Protein Sequence Length: 208 Download |
VSTATDASNN LPSPLSNATE LVGNFTRKGL TAEDMVVLSG AHTVGRSHCS SFTNRLYGFS 60 NASDVDPAIS SAYAFLLRSI CPSNSSQFVP NTTTDMDLIT PAVLDNKYYL GLANNLGLFT 120 SDQALLTNST LKKSVDEFVK SESRWKSKFA KAMVKMGNIE VLTGTQGEIR LNCRVINSGS 180 SAAGIELQMT SSSGDDSAEE STEIATN* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam00141 | peroxidase | 0.009 | 112 | 141 | 30 | + Peroxidase. |
pfam00141 | peroxidase | 2.0e-11 | 4 | 44 | 41 | + Peroxidase. |
cd00691 | ascorbate_peroxidase | 4.0e-12 | 10 | 156 | 155 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
PLN03030 | PLN03030 | 9.0e-28 | 1 | 177 | 182 | + cationic peroxidase; Provisional |
cd00693 | secretory_peroxidase | 1.0e-82 | 1 | 176 | 176 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EAY73805.1 | 0 | 1 | 187 | 79 | 266 | hypothetical protein OsI_01682 [Oryza sativa Indica Group] |
RefSeq | NP_001042908.1 | 0 | 1 | 181 | 149 | 330 | Os01g0327400 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001140982.1 | 0 | 1 | 207 | 159 | 362 | hypothetical protein LOC100273061 [Zea mays] |
RefSeq | NP_001141388.1 | 0 | 1 | 206 | 149 | 356 | hypothetical protein LOC100273479 [Zea mays] |
RefSeq | XP_002455568.1 | 0 | 1 | 202 | 164 | 368 | hypothetical protein SORBIDRAFT_03g013220 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hdl_A | 0 | 1 | 178 | 128 | 304 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
PDB | 3atj_B | 6e-39 | 7 | 180 | 135 | 309 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 3atj_A | 6e-39 | 7 | 180 | 135 | 309 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 1gwt_A | 6e-39 | 7 | 180 | 135 | 309 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 1gx2_B | 8e-39 | 7 | 180 | 135 | 309 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GD047294 | 196 | 17 | 208 | 0 |
EE015255 | 199 | 10 | 208 | 0 |
FL924374 | 157 | 52 | 208 | 0 |
HO146397 | 207 | 2 | 208 | 0 |
HO174442 | 191 | 18 | 208 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |