Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00005617m |
Family | AA2 |
Protein Properties | Length: 205 Molecular Weight: 21579.1 Isoelectric Point: 6.4846 |
Chromosome | Chromosome/Scaffold: 0183400 Start: 473 End: 1558 |
Description | Peroxidase superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 47 | 189 | 1.6e-36 |
DAVKARLAWDKRMVAGLLHLLFHDCFVTGCDASILLDGPNTEKTALQNNGLFGYDLIDDIKTTLENACPGVVSCADIIIAATRDAVGMCGGPTYQVQLGR RDGMVSQASMASILPGPNVDIPTAIDLFSKKGLNSFDMAILIG |
Full Sequence |
---|
Protein Sequence Length: 205 Download |
MQPARSAALL AAFVVVLASA VSCRAQLANN YYAGKCGNAS VETIIHDAVK ARLAWDKRMV 60 AGLLHLLFHD CFVTGCDASI LLDGPNTEKT ALQNNGLFGY DLIDDIKTTL ENACPGVVSC 120 ADIIIAATRD AVGMCGGPTY QVQLGRRDGM VSQASMASIL PGPNVDIPTA IDLFSKKGLN 180 SFDMAILIGT PPPTLRCHFL NPMP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd08201 | plant_peroxidase_like_1 | 1.0e-5 | 68 | 184 | 124 | + Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. | ||
cd00314 | plant_peroxidase_like | 2.0e-14 | 47 | 189 | 161 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN03030 | PLN03030 | 1.0e-51 | 31 | 201 | 172 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 3.0e-60 | 45 | 189 | 146 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 7.0e-84 | 26 | 189 | 167 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAK22416.1 | 0 | 1 | 198 | 1 | 200 | cationic peroxidase [Beta vulgaris] |
RefSeq | NP_001065427.1 | 0 | 5 | 189 | 12 | 205 | Os10g0566800 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002298276.1 | 0 | 20 | 189 | 2 | 175 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002321775.1 | 0 | 23 | 189 | 23 | 188 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002511053.1 | 0 | 23 | 189 | 25 | 190 | Peroxidase 60 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1qgj_B | 4e-39 | 26 | 189 | 1 | 163 | A Chain A, Arabidopsis Thaliana Peroxidase N |
PDB | 1qgj_A | 4e-39 | 26 | 189 | 1 | 163 | A Chain A, Arabidopsis Thaliana Peroxidase N |
PDB | 1sch_B | 3e-38 | 26 | 189 | 1 | 167 | A Chain A, Peanut Peroxidase |
PDB | 1sch_A | 3e-38 | 26 | 189 | 1 | 167 | A Chain A, Peanut Peroxidase |
PDB | 4a5g_B | 8e-38 | 31 | 189 | 8 | 169 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |