y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00006057m
FamilyCBM43
Protein PropertiesLength: 468 Molecular Weight: 50320.3 Isoelectric Point: 8.278
ChromosomeChromosome/Scaffold: 0179500 Start: 468 End: 1961
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433744604.4e-22
  WCVVRTDRGPANETAVREQVAAACADKAGLCDPVRPGGACYLPNTATAHASYVFSAHWNSFSEDYGGCYFGGLAVETTVDPSHASCK
GH17243470
  LGVNYGALGDNLPPPHRGIELARSAGAAAVRFYDANATLLAAAAASGLVFVPSVPNELIPSLAASRRAADAWVAAALLPFRRSPGLRYLFVGNEVLSDPT
  TRSRWPQLVPAMANVERALRRHGLGRVKVSTTFSTHDLDHQNVFPPSAAVFRPDIADAVMRPLLSFLERTESYLFFDAYTYFTWSANHSIVPLPYALLEP
  SPGFAYHDPGTGLSYANLLDQMLDAVVAAASRIGHCGVRLALAETGWPTAGDLDQFGANVRNAATYNRNLARHLASGAGTPRRPGMRMPAMVFALFNENL
  KWGPGTERHWGLFYPNGTAVYEVD
Full Sequence
Protein Sequence     Length: 468     Download
MSPLHLLLLV LATTTATTPT AHFLGVNYGA LGDNLPPPHR GIELARSAGA AAVRFYDANA    60
TLLAAAAASG LVFVPSVPNE LIPSLAASRR AADAWVAAAL LPFRRSPGLR YLFVGNEVLS    120
DPTTRSRWPQ LVPAMANVER ALRRHGLGRV KVSTTFSTHD LDHQNVFPPS AAVFRPDIAD    180
AVMRPLLSFL ERTESYLFFD AYTYFTWSAN HSIVPLPYAL LEPSPGFAYH DPGTGLSYAN    240
LLDQMLDAVV AAASRIGHCG VRLALAETGW PTAGDLDQFG ANVRNAATYN RNLARHLASG    300
AGTPRRPGMR MPAMVFALFN ENLKWGPGTE RHWGLFYPNG TAVYEVDLTG RRPLASYPPL    360
PPALNDRPYP GRLWCVVRTD RGPANETAVR EQVAAACADK AGLCDPVRPG GACYLPNTAT    420
AHASYVFSAH WNSFSEDYGG CYFGGLAVET TVDPSHASCK IPSILLK*                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X81.0e-1037344881+
smart00768X82.0e-2737346088+
pfam00332Glyco_hydro_176.0e-8124347325+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC76519.1034649471hypothetical protein OsI_14305 [Oryza sativa Indica Group]
GenBankEEC84834.101746524476hypothetical protein OsI_31928 [Oryza sativa Indica Group]
RefSeqNP_001051879.1034649471Os03g0845600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001063586.101046520479Os09g0502200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002463526.1024673483hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0243481312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0243481306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0243481306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghr_A0243481306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aq0_B0243481306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5722513081094140
DT7372832721974660
EE0439692551003520
EC9045942721003690
EE1582982551003520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)