y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00008164m
FamilyCBM43
Protein PropertiesLength: 488 Molecular Weight: 51068.6 Isoelectric Point: 7.4458
ChromosomeChromosome/Scaffold: 043098 Start: 4133 End: 5952
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433954814.4e-32
  WCVLAGGGKAADEKAVQAALDYACQQGSGTCTAIQPGGACYEPDTLDAHASYAFNSYWQQFRNSGGTCFFNGLAETTTKDPSHGSCK
GH17483700
  LGVNYGTVADDLPSAARSVQLLRAAGAGAVKIYDANSGILRALAGTGLPVAIMVPNAAIPSLASSRAAAEDWVAANLAPHSPATRVMYLLVGNEVLSDRA
  IAGSTWRAIVPAMANLHRALRAHGIRKVKLGTTLAMGALSASYPPSAGAFRDDVAEDVVRPLLRFLNATRSFYFVDAYPYFAWAANRDAISLDYALFQGA
  ASSHYVDPGTGLTYTNLLDQMLDAVVAAMGKLGYGDVKLAVSETGWPSAGDAGEAGANVRNAATYNRNLAARMSRNPGTPARPGAKMPVFLFSLYNEDQK
  PGAGTERHWGLYYPNQTKVYEID
Full Sequence
Protein Sequence     Length: 488     Download
MAAATVAPSS PHRAVAVLLL AAALACHPNV VAAVNPECRC PGGKCRGLGV NYGTVADDLP    60
SAARSVQLLR AAGAGAVKIY DANSGILRAL AGTGLPVAIM VPNAAIPSLA SSRAAAEDWV    120
AANLAPHSPA TRVMYLLVGN EVLSDRAIAG STWRAIVPAM ANLHRALRAH GIRKVKLGTT    180
LAMGALSASY PPSAGAFRDD VAEDVVRPLL RFLNATRSFY FVDAYPYFAW AANRDAISLD    240
YALFQGAASS HYVDPGTGLT YTNLLDQMLD AVVAAMGKLG YGDVKLAVSE TGWPSAGDAG    300
EAGANVRNAA TYNRNLAARM SRNPGTPARP GAKMPVFLFS LYNEDQKPGA GTERHWGLYY    360
PNQTKVYEID LTGQRPSRSY PPLPPADDTD SSPAWCVLAG GGKAADEKAV QAALDYACQQ    420
GSGTCTAIQP GGACYEPDTL DAHASYAFNS YWQQFRNSGG TCFFNGLAET TTKDPSHGSC    480
KFLSSED*                                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53093.0e-6204362164+
pfam07983X82.0e-1739546883+
smart00768X81.0e-3739548288+
pfam00332Glyco_hydro_173.0e-10848370324+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN29077.101004871384unknown [Zea mays]
DDBJBAF24208.204747632467Os08g0525800 [Oryza sativa Japonica Group]
GenBankEAZ07710.104747632467hypothetical protein OsI_29967 [Oryza sativa Indica Group]
RefSeqNP_001062294.104747732468Os08g0525800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002444717.1064871484hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0483711312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A0483711306A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B0483711306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A0483711306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1ghs_B0483711306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Signal Peptide
Cleavage Site
33
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC9045942781163890
EE1582982721163840
EE181046257262800
EE0439692641163760
EE0457692611273840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)