CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00008779m
FamilyCE10
Protein PropertiesLength: 831 Molecular Weight: 91261 Isoelectric Point: 6.941
ChromosomeChromosome/Scaffold: 005383 Start: 6779 End: 14174
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105928138.4e-33
  SASNPTIVVLHGGPHSVYPSSYSKSLAFLFSQGYNLLVVNYRGSLGFGEEALQSLPGNIGSQDVNDVLTALDFVIKRGLIDPSRVAVVGGSHGGFLTTHL
  IGQAPDTFVAAAARNPVCNLQLMVGTTDIPDWCFVEIYGKDGKKYFSESPSVDDLCQFHQKSPISHISKVKTPTLFLLGAQDLRVPVSNGLQYARALKER
  GIESKTIVFPEDIHGIDKPQSD
Full Sequence
Protein Sequence     Length: 831     Download
MVVLTTTFIS CAKFRCHSIA VVNLLPVSAF PSPARALPRG PLLRQRISKV SLHSLAMAAS    60
EASEAAADKG LPFGVDATMV DEYASQSKLL QEFVKIPSFG KAWVFNSKDE NTPRAAVSIS    120
QSDLLGNKRR MFLLNSHISK SASKPVNFQW SPFPTEISGV SAVIPSPSGE KLLLVRNSED    180
DSPTKLEIWG ACQLENEIHI AKSVHGSLYT DEWFEGISWN KDETFIAYVA EEPPQPKPVF    240
NDYGFKKEGS SEKDCKSWKG QGDWEETWGE TYSKKRIPAL FVVNISSGQV RPVKGIPRSL    300
SVGQVIWAPS SSCGLVFVAW SSDNGFQETP RKLGIKYCYN RPCALYAAPD PFREETEKPS    360
TVGNKDETTT MIKLTAHLSS AFFPRFSPDG KYLVFVSAKS AVDSGAHNAT NSMHRIEWPT    420
DGKLDGSLGI VDVVPIVMCP KDNCFPGLYC FGLLRDPWLT DGRTMILSSV WGSREVILSV    480
NVVSCEVLRV SPQDSDYSWN VLALDKNNIL AVSSSLITLP QIYYGIMISQ TESHWEWQEV    540
STPFPKPSDE ISSILAEHKF SILKIPISNP SDKLAHGAKL PFEAIFVSHK DSASNPTIVV    600
LHGGPHSVYP SSYSKSLAFL FSQGYNLLVV NYRGSLGFGE EALQSLPGNI GSQDVNDVLT    660
ALDFVIKRGL IDPSRVAVVG GSHGGFLTTH LIGQAPDTFV AAAARNPVCN LQLMVGTTDI    720
PDWCFVEIYG KDGKKYFSES PSVDDLCQFH QKSPISHISK VKTPTLFLLG AQDLRVPVSN    780
GLQYARALKE RGIESKTIVF PEDIHGIDKP QSDFESFLNI GVWFKKHMSK *             840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes7.0e-11566829281+
pfam12697Abhydrolase_63.0e-11598801204+
COG1505COG15055.0e-12577792226+
pfam00326Peptidase_S93.0e-38612830221+
COG1506DAP29.0e-52372830470+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47613.104483052839prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABB47614.10758291764prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064602.10578301775Os10g0415600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064603.10688294774Os10g0415800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151758.10578301774LOC100285393 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B6e-20590806373579A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB4hxe_B6e-20590806373579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L1e-19590806373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K1e-19590806373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J1e-19590806373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8504863414888260
GO8504843364888210
JG8943692834407220
JG9025472763235980
JG9230542805047830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810mPavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)