CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00011477m
FamilyGT1
Protein PropertiesLength: 479 Molecular Weight: 51841.5 Isoelectric Point: 5.8919
ChromosomeChromosome/Scaffold: 082701 Start: 400 End: 1836
DescriptionUDP-glucosyl transferase 88A1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11214499.1e-35
  TFIDVCRDLAVPAYVYFTSNAATLALMLRLPALHEEVTVEFEEMEGAVDMPGLPPVPPSSLPTPVMDKKNPNYTWFVYHGRRFAEADGIIANTAAELERS
  TLAAIADGRCTPGVRPPTVYPVGPVISFASPPDPEQPHECVRWLDAQPPASVSLLCFGSQGFFAAPQAHEIARGLERSGHRFLWVLRGPSAPGAMRPTDA
  NLAELLPEGFLERTKDRGLVWPTWAPQREILAHAAVGGFVTHGGWNSTLESLWHGVPLAPWPLYAEQHLNAFILVAAMGVAVAMKVDRKRDNFVEAAELE
  RAVRELMGGGEEGRKAREKAVEMKAACRN
Full Sequence
Protein Sequence     Length: 479     Download
MATPTVVLVP MWGTGHLMSL LEAGKWLVGR AGRAISLTVL VMRPPTEQLA AEVEGHVRRE    60
EGSGLDVRFV HLPAVEPPTD YAGIEEFVSR FVQMHAPHVQ AAISSSASLV AAVVLDFFCT    120
TFIDVCRDLA VPAYVYFTSN AATLALMLRL PALHEEVTVE FEEMEGAVDM PGLPPVPPSS    180
LPTPVMDKKN PNYTWFVYHG RRFAEADGII ANTAAELERS TLAAIADGRC TPGVRPPTVY    240
PVGPVISFAS PPDPEQPHEC VRWLDAQPPA SVSLLCFGSQ GFFAAPQAHE IARGLERSGH    300
RFLWVLRGPS APGAMRPTDA NLAELLPEGF LERTKDRGLV WPTWAPQREI LAHAAVGGFV    360
THGGWNSTLE SLWHGVPLAP WPLYAEQHLN AFILVAAMGV AVAMKVDRKR DNFVEAAELE    420
RAVRELMGGG EEGRKAREKA VEMKAACRNA VEEGGSSDSA LRRLAEQLYK GAVVSTSK*     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02207PLN022076.0e-681394408+
PLN03004PLN030041.0e-751394402+
PLN02167PLN021676.0e-811473494+
PLN02554PLN025548.0e-906470489+
PLN00164PLN0016401476479+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC83989.1014681469putative flavonol 3-O-glucosyltransferase [Oryza sativa Japonica Group]
RefSeqNP_001148465.1014701471anthocyanidin 3-O-glucosyltransferase [Zea mays]
RefSeqXP_002448067.1014701475hypothetical protein SORBIDRAFT_06g020440 [Sorghum bicolor]
RefSeqXP_002460739.1014681466hypothetical protein SORBIDRAFT_02g034120 [Sorghum bicolor]
RefSeqXP_002460740.1014681467hypothetical protein SORBIDRAFT_02g034130 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2acv_B0646812461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A0646812461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vg8_A034656464A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vch_A034656464A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vce_A034656464A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
rose anthocyanin biosynthesisRXN-8005EC-2.4.1UDP-D-glucose:cyanidin 5-O-β-D-glucosyltransferase
rose anthocyanin biosynthesisRXN-8006EC-2.4.1cyanidin 5,3-O-glycosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV5336613011514500
FL9497522251894130
FL835282234322650
DV50934029312920
EE16861427762810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00243.1Aquca_020_00570.1Aquca_016_00047.1Aquca_016_00048.1
Arabidopsis lyrata470743887936901945856204481887
481893901948470742898631479701
493362915287333019479703898625
493361342328
Arabidopsis thalianaAT2G29730.1AT1G07260.1AT1G07250.1AT2G29710.1AT2G29740.1
AT2G29750.1AT1G07240.1AT3G21790.1AT3G21800.1AT4G15280.1
AT3G21760.1AT3G21780.1AT4G15260.1AT3G21750.1
Brachypodium distachyonBradi1g26760.1Bradi2g08310.1Bradi1g23110.1Bradi1g24660.1Bradi1g26750.1
Bradi1g26790.1Bradi1g26770.1Bradi1g24667.1
Brassica rapaBra015568Bra007812Bra018364Bra018363Bra031559
Bra000471Bra015567Bra039557Bra031303Bra001845
Bra012795Bra001847Bra001846Bra023863Bra031304
Bra031307Bra031310Bra031561Bra031306Bra023861
Carica papayaevm.model.supercontig_8.229evm.model.supercontig_8.271evm.model.supercontig_8.227evm.model.supercontig_8.266evm.model.supercontig_1056.1
Capsella rubellaCarubv10009021mCarubv10009025mCarubv10009037mCarubv10025242mCarubv10023111m
Carubv10016887mCarubv10015440mCarubv10013556mCarubv10007776mCarubv10004730m
Carubv10026313mCarubv10013615mCarubv10013591mCarubv10013590mCarubv10015093m
Carubv10015326mCarubv10016519m
Citrus clementinaCiclev10011659mCiclev10014993mCiclev10013653mCiclev10018337mCiclev10011544m
Ciclev10011522m
Citrus sinensisorange1.1g045570morange1.1g043290morange1.1g011311morange1.1g045029morange1.1g047945m
Cucumis sativusCucsa.058290.1Cucsa.134570.1Cucsa.058370.1Cucsa.058340.1Cucsa.058380.1
Cucsa.058390.1Cucsa.058360.1Cucsa.058400.1Cucsa.058480.1
Eucalyptus grandisEucgr.J01922.1Eucgr.E04316.1Eucgr.E04315.1Eucgr.K01350.1Eucgr.L01241.1
Eucgr.A00945.1Eucgr.A00935.1Eucgr.A00926.1Eucgr.A00940.1Eucgr.A00934.1
Eucgr.A00919.1Eucgr.A00936.1Eucgr.A00938.1Eucgr.A00933.1Eucgr.A00920.1
Eucgr.A00937.1Eucgr.A00927.1Eucgr.A00932.1Eucgr.A00942.1Eucgr.A00947.1
Eucgr.A00930.1Eucgr.A00929.1Eucgr.C01648.1Eucgr.A00948.1Eucgr.A00943.1
Eucgr.A00917.1
Fragaria vescamrna24227.1-v1.0-hybridmrna07876.1-v1.0-hybridmrna22710.1-v1.0-hybridmrna22709.1-v1.0-hybridmrna24696.1-v1.0-hybrid
mrna19965.1-v1.0-hybridmrna24226.1-v1.0-hybridmrna24225.1-v1.0-hybridmrna20181.1-v1.0-hybridmrna24224.1-v1.0-hybrid
mrna22597.1-v1.0-hybridmrna24695.1-v1.0-hybridmrna19964.1-v1.0-hybrid
Glycine maxGlyma02g39080.2Glyma02g39090.2Glyma02g39090.1Glyma14g37170.1Glyma09g09910.1
Glyma02g47990.1
Gossypium raimondiiGorai.009G071600.1Gorai.013G260500.2Gorai.001G214000.1Gorai.003G149300.1Gorai.013G260500.1
Gorai.008G051100.1Gorai.008G051000.1Gorai.005G073700.1Gorai.001G214300.1Gorai.009G071500.1
Gorai.003G123200.1Gorai.008G051000.2Gorai.005G073500.1
Linum usitatissimumLus10026793Lus10039037Lus10026795Lus10036087Lus10027334
Lus10036088Lus10036086Lus10003805Lus10010476
Malus domesticaMDP0000215525MDP0000092033MDP0000163017MDP0000323136MDP0000735095
MDP0000553484MDP0000426138MDP0000715898MDP0000058337MDP0000307237
MDP0000290801MDP0000242552MDP0000306121MDP0000769764MDP0000899508
MDP0000584567MDP0000873295MDP0000806350MDP0000238976MDP0000437996
MDP0000122122
Manihot esculentacassava4.1_032692mcassava4.1_006457mcassava4.1_031134mcassava4.1_031478mcassava4.1_006857m
cassava4.1_007027mcassava4.1_007099mcassava4.1_027138mcassava4.1_007029mcassava4.1_025684m
cassava4.1_018585m
Medicago truncatulaMedtr5g070090.1Medtr5g090670.1Medtr5g070040.1Medtr5g090630.1Medtr5g098930.1
Medtr5g090660.1Medtr5g090620.1Medtr5g090700.1Medtr5g090610.1Medtr5g090580.1
Medtr5g090600.1Medtr5g090690.1
Mimulus guttatusmgv1a005089mmgv1a025629mmgv1a003831mmgv1a023772mmgv1a020444m
mgv1a004831m
Oryza sativaLOC_Os07g32060.1LOC_Os07g32020.1LOC_Os07g31960.1LOC_Os07g32620.1LOC_Os07g37690.1
LOC_Os07g32630.1LOC_Os07g32010.1
Panicum virgatumPavirv00038813mPavirv00046201mPavirv00060850mPavirv00004183mPavirv00042016m
Pavirv00013870mPavirv00052098mPavirv00011783mPavirv00046092mPavirv00031799m
Pavirv00064006mPavirv00050397mPavirv00067120mPavirv00059544m
Phaseolus vulgarisPhvul.008G262100.1Phvul.008G262000.1Phvul.009G218800.1Phvul.008G290300.1Phvul.008G290200.1
Populus trichocarpaPotri.016G016900.1Potri.009G044600.1Potri.009G044600.2Potri.016G015700.1Potri.016G015800.1
Potri.006G010000.1Potri.016G014500.1Potri.016G014100.1Potri.016G014400.1Potri.016G014300.1
Potri.016G017300.1Potri.016G014500.2Potri.006G007000.1Potri.016G016500.1Potri.016G017100.1
Potri.016G016000.1Potri.016G017200.1Potri.006G007100.1Potri.006G007300.1Potri.016G016800.1
Potri.014G026300.1Potri.016G017400.1Potri.016G016700.1Potri.016G016300.1Potri.016G016100.1
Potri.016G016200.1Potri.006G007200.1Potri.006G007400.1Potri.016G016400.1Potri.016G017000.1
Potri.006G007600.1
Prunus persicappa004906mppa007869mppa024083mppa018557mppa005052m
ppa005290mppa004957mppa021727mppa005277mppa004725m
ppa025943mppa018805m
Ricinus communis29681.m00133029681.m00133129994.m00046129724.m00084629724.m000844
Setaria italicaSi029670mSi029690mSi031935mSi029664mSi029787m
Si029659mSi032839mSi029729mSi027371m
Sorghum bicolorSb02g034150.1Sb10g004240.1Sb02g034110.1Sb02g034120.1Sb02g034130.1
Sb10g004230.1Sb06g020440.1Sb02g034160.1Sb02g034140.1Sb02g034170.1
Sb02g034100.1Sb02g011220.1Sb07g002380.1
Thellungiella halophilaThhalv10009289mThhalv10007440mThhalv10007519mThhalv10025075mThhalv10020645m
Thhalv10021907mThhalv10020628m
Vitis viniferaGSVIVT01029671001GSVIVT01029680001GSVIVT01015859001GSVIVT01036732001GSVIVT01023095001
GSVIVT01023005001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)