y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00013474m
FamilyGT47
Protein PropertiesLength: 563 Molecular Weight: 62156.1 Isoelectric Point: 8.2653
ChromosomeChromosome/Scaffold: 0186495 Start: 187 End: 2185
Descriptionglycosyltransferase 18
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47774290
  CEAGLVYVYDLPPEFNHDLVDDCESLWPWYSFCPYLTNGGFGEAAATLPVFFNVTRNVSLHSWYNTDQFQLEVIVHRRLLSHRCRTTDPSQASAFYVPFY
  VGLDVGSHLWGDNSTAADRDRAGLRLLRWLQNQTSFQRSGGWDHFITLGRITWDFRRYGDDGWGTNFVVLPGMTNVTRLAIEADTLDPMDVGVPYPTGFH
  PRAAADVRAWQRHVLSRRRSKLFGFAGAPRSGFRGDFRGVLLEECEDAGSERCRAVDCRGTRCTDNGAAVLELFLDSRFCLQPRGDSFTRRSMFDCMVAG
  AVPVLFWRRTAYDQYRWYLPPGPRGDRGEWSVFIDRRALRAGNVSVRDVLEGI
Full Sequence
Protein Sequence     Length: 563     Download
MPESPEPSST PGSPLDAATP SPVPALLRGS LLLLAFLVLQ LVLFWSLLGS PASSRFLPAP    60
GRRNTTWPNG AVDAGACEAG LVYVYDLPPE FNHDLVDDCE SLWPWYSFCP YLTNGGFGEA    120
AATLPVFFNV TRNVSLHSWY NTDQFQLEVI VHRRLLSHRC RTTDPSQASA FYVPFYVGLD    180
VGSHLWGDNS TAADRDRAGL RLLRWLQNQT SFQRSGGWDH FITLGRITWD FRRYGDDGWG    240
TNFVVLPGMT NVTRLAIEAD TLDPMDVGVP YPTGFHPRAA ADVRAWQRHV LSRRRSKLFG    300
FAGAPRSGFR GDFRGVLLEE CEDAGSERCR AVDCRGTRCT DNGAAVLELF LDSRFCLQPR    360
GDSFTRRSMF DCMVAGAVPV LFWRRTAYDQ YRWYLPPGPR GDRGEWSVFI DRRALRAGNV    420
SVRDVLEGIS ERRARRMQER VVEMVPRLVY ASPSSDGLGD GMEDALDVAL GGVLERMRRR    480
RGSIVPREGQ SHLHPEGPFV ARRVDVESTA AAPHSDGKNG SAAASGRGAA GKNQDPPASS    540
HIKTALPEAS ASIRKTLQKS LN*                                            600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin3.0e-5076429365+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY95237.107748364467hypothetical protein OsI_17054 [Oryza sativa Indica Group]
GenBankEAZ00823.101249315493hypothetical protein OsI_22853 [Oryza sativa Indica Group]
GenBankEAZ36900.101249315493hypothetical protein OsJ_21244 [Oryza sativa Japonica Group]
RefSeqNP_001057569.101256015556Os06g0342000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002448367.1015601568hypothetical protein SORBIDRAFT_06g026010 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2648
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE1618282651233870
EE1805972431453870
EE1618292401483870
EE1805962341233560
DY2903733591114690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00701.1Aquca_025_00047.1Aquca_038_00043.1Aquca_003_00092.1Aquca_013_00533.1
Aquca_030_00256.1
Arabidopsis lyrata480865901861359365902333493853
915506344960482210492611919476
339091893098920989
Arabidopsis thalianaAT2G29040.1AT2G20370.1AT5G41250.1AT1G63450.1AT2G32750.1
AT4G13990.1AT4G22580.1AT2G31990.1AT2G32740.1AT5G62220.1
AT1G68470.1
Brachypodium distachyonBradi1g75450.1Bradi3g28020.1Bradi3g28027.1Bradi1g13110.1Bradi3g28012.1
Bradi3g28006.1Bradi3g32980.1Bradi3g28040.1Bradi1g78280.1Bradi5g18940.1
Bradi5g18927.1Bradi3g47480.1Bradi4g40070.1
Brassica rapaBra036680Bra036467Bra022900Bra028388Bra035655
Bra028492Bra022874Bra027802Bra005627Bra038960
Bra005559Bra021811Bra010065Bra004310Bra021763
Bra013627
Carica papayaevm.model.supercontig_29.130evm.model.supercontig_8.309evm.model.supercontig_81.132evm.model.supercontig_157.42evm.model.supercontig_3.255
evm.model.supercontig_157.43evm.model.supercontig_74.20
Capsella rubellaCarubv10025159mCarubv10013229mCarubv10023021mCarubv10006479mCarubv10025252m
Carubv10021808mCarubv10007051mCarubv10025326mCarubv10004820mCarubv10028275m
Carubv10020285m
Citrus clementinaCiclev10020110mCiclev10004973mCiclev10006440mCiclev10004838mCiclev10004905m
Ciclev10004921mCiclev10006490m
Citrus sinensisorange1.1g007197morange1.1g012984morange1.1g045731morange1.1g046652morange1.1g011220m
orange1.1g012090morange1.1g016487morange1.1g047350m
Cucumis sativusCucsa.140650.1Cucsa.320620.1Cucsa.135930.1Cucsa.095020.1Cucsa.125430.1
Cucsa.251330.1Cucsa.104410.1Cucsa.115600.1
Eucalyptus grandisEucgr.E00459.1Eucgr.A01318.1Eucgr.B02354.1Eucgr.H00492.1Eucgr.H02673.1
Eucgr.D01858.1Eucgr.A02868.1Eucgr.H02667.1Eucgr.D00738.1Eucgr.H00343.1
Fragaria vescamrna08349.1-v1.0-hybridmrna06574.1-v1.0-hybridmrna29211.1-v1.0-hybridmrna32241.1-v1.0-hybridmrna02225.1-v1.0-hybrid
mrna32454.1-v1.0-hybridmrna06576.1-v1.0-hybridmrna13394.1-v1.0-hybridmrna06572.1-v1.0-hybridmrna16329.1-v1.0-hybrid
mrna16326.1-v1.0-hybridmrna06573.1-v1.0-hybridmrna16325.1-v1.0-hybrid
Glycine maxGlyma13g18940.3Glyma13g18940.2Glyma10g04640.1Glyma19g35210.3Glyma19g35210.2
Glyma03g32481.1Glyma17g02880.1Glyma18g00560.1Glyma11g36640.1Glyma18g52010.1
Glyma18g52000.2Glyma11g02640.1Glyma08g29110.2Glyma20g29030.2Glyma20g00760.1
Glyma07g37751.1
Gossypium raimondiiGorai.007G150100.1Gorai.003G169500.1Gorai.006G224200.1Gorai.004G211300.1Gorai.011G152000.1
Gorai.001G111200.1Gorai.011G152600.1Gorai.006G226500.1Gorai.008G283000.3Gorai.008G283000.2
Gorai.008G283000.1Gorai.007G009300.1Gorai.009G098600.1Gorai.005G266400.1Gorai.009G374500.1
Gorai.001G182200.1
Linum usitatissimumLus10022862Lus10024961Lus10007037Lus10000604Lus10028924
Lus10006694Lus10016532Lus10004341Lus10001578Lus10004967
Lus10007426Lus10010677Lus10001028Lus10027386Lus10031685
Lus10015022Lus10013701Lus10005566Lus10013700Lus10005567
Lus10003440
Malus domesticaMDP0000697213MDP0000669665MDP0000204575MDP0000224103MDP0000315108
MDP0000317620MDP0000775334MDP0000899392MDP0000186840MDP0000661731
MDP0000317931MDP0000317621MDP0000839295MDP0000306185MDP0000301100
MDP0000828513MDP0000951395MDP0000131360MDP0000130660MDP0000133266
MDP0000290571MDP0000322393MDP0000132843MDP0000630192
Manihot esculentacassava4.1_004268mcassava4.1_004031mcassava4.1_032775mcassava4.1_007677mcassava4.1_026371m
cassava4.1_007928mcassava4.1_022618mcassava4.1_025515mcassava4.1_021548mcassava4.1_033519m
cassava4.1_005862mcassava4.1_023212mcassava4.1_029120m
Medicago truncatulaMedtr7g098650.1Medtr4g119810.1Medtr3g084400.1Medtr5g055350.1Medtr5g010370.1
Medtr5g010350.1Medtr5g095940.1Medtr1g102430.1Medtr3g007840.1Medtr5g095950.1
Mimulus guttatusmgv1a025815mmgv1a025992mmgv1a006271mmgv1a023797mmgv1a021582m
mgv1a007352mmgv1a004562m
Oryza sativaLOC_Os03g05110.1LOC_Os10g32170.1LOC_Os03g05060.2LOC_Os03g05060.1LOC_Os03g05070.1
LOC_Os12g38450.1LOC_Os10g32160.1LOC_Os10g32080.1LOC_Os10g40559.1LOC_Os06g23420.2
LOC_Os06g23420.1LOC_Os04g48480.1LOC_Os10g32110.1LOC_Os12g12290.1
Panicum virgatumPavirv00052911mPavirv00016514mPavirv00047043mPavirv00048669mPavirv00034812m
Pavirv00004154mPavirv00053716mPavirv00004155mPavirv00005480mPavirv00064113m
Pavirv00040881mPavirv00057287mPavirv00002639mPavirv00049145mPavirv00052250m
Pavirv00050116mPavirv00058137mPavirv00027041mPavirv00013287mPavirv00004398m
Pavirv00043727mPavirv00065473mPavirv00037613mPavirv00043360mPavirv00010825m
Pavirv00004150mPavirv00045520mPavirv00002799m
Physcomitrella patensPp1s5_379V6.1Pp1s158_189V6.1Pp1s47_268V6.1Pp1s60_282V6.1Pp1s5_370V6.1
Pp1s88_148V6.1Pp1s530_2V6.1Pp1s530_5V6.1Pp1s81_221V6.1Pp1s36_237V6.1
Pp1s21_30V6.1Pp1s1_428V6.1Pp1s26_8V6.1Pp1s236_30V6.1Pp1s20_115V6.1
Pp1s512_4V6.1Pp1s3_407V6.2Pp1s3_407V6.1Pp1s1_374V6.1
Phaseolus vulgarisPhvul.007G153600.1Phvul.001G266100.1Phvul.003G104800.2Phvul.003G104800.1Phvul.007G063500.1
Phvul.008G017900.1Phvul.002G157100.1Phvul.003G006800.1Phvul.001G165300.1
Picea abiesMA_10434404g0030MA_9990400g0010MA_371148g0010MA_372623g0010MA_100374g0010
MA_290104g0010MA_73539g0010MA_13968g0020MA_96103g0010MA_5948g0010
MA_76602g0010.250.389MA_76602g0010.250.389MA_10435411g0010MA_28102g0010.178.308MA_28102g0010.178.308
MA_7543346g0010
Populus trichocarpaPotri.002G256200.2Potri.002G256200.1Potri.001G120800.1Potri.014G147800.1Potri.009G032500.1
Potri.001G105300.1Potri.001G321000.1Potri.012G130700.1Potri.015G132600.1Potri.001G382200.1
Potri.001G381900.1Potri.003G112200.1Potri.003G126000.1
Prunus persicappa002811mppa005908mppa024321mppa016857mppa018367m
ppa018375mppa004844mppa006308mppa007371mppa007598m
ppa003851mppa004838mppa017713mppa008689mppa017934m
ppa025271m
Ricinus communis30190.m01120329002.m00014928455.m00036930065.m00113829637.m000730
30065.m00114130147.m01416130065.m00113628223.m000097
Setaria italicaSi034744mSi038964mSi035153mSi039422mSi038531m
Si039200mSi025042mSi039123mSi039377mSi019878m
Si012021mSi035637mSi036091mSi024608mSi008588m
Si004223m
Selaginella moellendorffii1012371181338576912679964314
126225123197983663817126870
Sorghum bicolorSb01g020070.1Sb01g047270.1Sb01g020080.1Sb01g047290.1Sb01g020060.1
Sb01g047300.1Sb08g018880.1Sb01g047280.1Sb01g047310.1Sb06g026020.1
Sb06g026010.1Sb01g047315.1Sb01g050380.1Sb01g029520.1Sb08g007160.1
Thellungiella halophilaThhalv10001932mThhalv10016337mThhalv10017561mThhalv10017898mThhalv10024922m
Thhalv10016613mThhalv10025220mThhalv10028137mThhalv10005582mThhalv10027680m
Thhalv10018517mThhalv10023358m
Vitis viniferaGSVIVT01019767001GSVIVT01031644001GSVIVT01028435001GSVIVT01004778001GSVIVT01001277001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)