y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00016935m
FamilyGT29
Protein PropertiesLength: 450 Molecular Weight: 49578.2 Isoelectric Point: 9.4759
ChromosomeChromosome/Scaffold: 062673 Start: 1503 End: 4994
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291523530
  NKCQNRTLCMEQLLLVLPETSPYVPRQFGRCAVVGNSGDLLKTKFGDEIDSYDVVFRENGAPIQNYTEYVGSKSTFRLLNRGSAKALDKVVELDETKKEV
  LIVKTTIHDIMNQMIREVPITNPVYLMLGTSSSFGSSAKGTGVKALEFALSICDSVDMYGFTVDPGYKEWTRYFSKARKGHTPLHGRAYYQMMECLGLVK
  IH
Full Sequence
Protein Sequence     Length: 450     Download
MAPRVAPAVR VLPLALAAAI FSGVTAILIY LSGLSSYGNA RLSESDLAAL AALQGRFSKC    60
VDANGLGLKV VSGKDYCRVV IQYPSNTVSK WTDPSTGQVE GLSFEFNLCE AVASWEQVRN    120
STTVLTKEYI DALPNGWEEY AWRRINKGNL LNKCQNRTLC MEQLLLVLPE TSPYVPRQFG    180
RCAVVGNSGD LLKTKFGDEI DSYDVVFREN GAPIQNYTEY VGSKSTFRLL NRGSAKALDK    240
VVELDETKKE VLIVKTTIHD IMNQMIREVP ITNPVYLMLG TSSSFGSSAK GTGVKALEFA    300
LSICDSVDMY GFTVDPGYKE WTRYFSKARK GHTPLHGRAY YQMMECLGLV KIHSLMRGDP    360
GRAVKWLPTK DIIEAARVAS EKLLRRPGAG RDGPMGTCTM IKKRKKGKEP NRSGLRDAAM    420
KHLEYMKGAT RYPLERSAGG GYLCMINDT*                                     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_294.0e-51158354246+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15156.103644828438sialyltransferase-like protein [Triticum aestivum]
GenBankEEC72354.103544827426hypothetical protein OsI_05598 [Oryza sativa Indica Group]
RefSeqNP_001045694.103544827438Os02g0118400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105843.105444855447sialyltransferase like protein [Zea mays]
RefSeqXP_002451395.1014481447hypothetical protein SORBIDRAFT_04g001370 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wml_A0.00000000000000314232559259A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
PDB2wnf_A0.00000000000000314232559259A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
PDB2wnb_A0.00000000000000314232559259A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO872329373744460
GO8851623021384390
GO7934322931224140
GO793432274144400.0001
GO79343284394460.0001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)