y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00016961m
FamilyGT41
Protein PropertiesLength: 369 Molecular Weight: 42166.3 Isoelectric Point: 6.1842
ChromosomeChromosome/Scaffold: 063619 Start: 162 End: 3233
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT411473480
  PHKRSDYGLPEDKFIFACFNQLYKMDPEIFDTWCNILKRVPNSALWLLRFPAAGETRVRSHAAARGVRPDQIIFTDVAMKNEHIRRSQLADLFLDTPLCN
  AHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKEYEERAVELALNPAKLQSLTNKLKEVRMSCPLFDTARWVRNLERAYYKMWNLY
  CS
Full Sequence
Protein Sequence     Length: 369     Download
MGSVFGMHDR DNIEVFCYAL SQNDGTEWRQ RIQSEAEHFV DVSAMTSDMI ARLINQDKIQ    60
ILINLNGYTK GARNEIFALQ PAPIQVSYMG FPGTTGAAYI DYLVTDEFVS PSCYAHIYSE    120
KLVHLPHCYF VNDYKQKNQD CLTPVCPHKR SDYGLPEDKF IFACFNQLYK MDPEIFDTWC    180
NILKRVPNSA LWLLRFPAAG ETRVRSHAAA RGVRPDQIIF TDVAMKNEHI RRSQLADLFL    240
DTPLCNAHTT GTDILWAGLP MITLPLEKMA TRVAGSLCVA TGLGEEMIVS SMKEYEERAV    300
ELALNPAKLQ SLTNKLKEVR MSCPLFDTAR WVRNLERAYY KMWNLYCSGR HPEPFKVEED    360
 DKEFPFDR*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_418.0e-601136137+
pfam13844Glyco_transf_411.0e-80150343194+
COG3914Spy4.0e-971346348+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN26645.1013686421009unknown [Zea mays]
GenBankEEC73199.1013686351004hypothetical protein OsI_07263 [Oryza sativa Indica Group]
GenBankEEE57013.1013686351004hypothetical protein OsJ_06783 [Oryza sativa Japonica Group]
RefSeqXP_002270163.101368619986PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002453843.1013686441011hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D0150353514716X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB4gz6_D2.99878e-431134256390X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB4gz6_C0150353514716X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB4gz6_C2.99878e-431134256390X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
PDB4gz6_B0150353514716X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77872536913690
HO79524736913690
GT034150327163420
GO88155331113110
GO881553263053300.00005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.334.533Aquca_058_00216.4.334.533Aquca_058_00216.3.560.759Aquca_058_00216.3.560.759Aquca_058_00216.1.773.973
Aquca_058_00216.1.773.973
Arabidopsis lyrata896453.754.961896453.754.961
Arabidopsis thalianaAT3G04240.1.754.961AT3G04240.1.754.961
Brachypodium distachyonBradi3g43577.3.780.979Bradi3g43577.3.780.979Bradi5g06647.1.792.998Bradi5g06647.1.792.998Bradi2g58616.1.761.965
Bradi2g58616.1.761.965
Brassica rapaBra040144.752.961Bra040144.752.961
Carica papayaevm.model.supercontig_51.46.533.743evm.model.supercontig_51.46.533.743
Capsella rubellaCarubv10012900m.754.955Carubv10012900m.754.955
Citrus clementinaCiclev10018711m.753.949Ciclev10018711m.753.949
Citrus sinensisorange1.1g003557m.591.791orange1.1g003557m.591.791orange1.1g002431m.702.902orange1.1g002431m.702.902orange1.1g002729m.702.886
orange1.1g002729m.702.886
Cucumis sativusCucsa.027630.1.766.964Cucsa.027630.1.766.964
Eucalyptus grandisEucgr.L00641.1.730.929Eucgr.L00641.1.730.929
Fragaria vescamrna16720.1-v1.0-hybrid.753.952mrna16720.1-v1.0-hybrid.753.952
Glycine maxGlyma10g31190.1.767.969Glyma10g31190.1.767.969Glyma20g36330.1.767.969Glyma20g36330.1.767.969
Gossypium raimondiiGorai.007G271100.1Gorai.013G189100.3.575.778Gorai.013G189100.3.575.778Gorai.013G189100.1.770.972Gorai.013G189100.1.770.972
Gorai.011G150500.5.705.913Gorai.011G150500.5.705.913Gorai.011G150500.4.705.913Gorai.011G150500.4.705.913Gorai.011G150500.2.778.986
Gorai.011G150500.2.778.986Gorai.011G150500.1.784.992Gorai.011G150500.1.784.992Gorai.007G271100.2Gorai.013G189100.2.770.954
Gorai.013G189100.2.770.954
Linum usitatissimumLus10003576.755.956Lus10003576.755.956Lus10004779.756.956Lus10004779.756.956Lus10003113.756.956
Lus10003113.756.956
Malus domesticaMDP0000233292.759.959MDP0000233292.759.959
Manihot esculentacassava4.1_001015m.753.953cassava4.1_001015m.753.953cassava4.1_002695m.485.686cassava4.1_002695m.485.686cassava4.1_002691m.485.686
cassava4.1_002691m.485.686cassava4.1_001021m.752.953cassava4.1_001021m.752.953
Medicago truncatulaMedtr1g079510.2.521.726Medtr1g079510.2.521.726Medtr1g079510.1.763.967Medtr1g079510.1.763.967
Mimulus guttatusmgv1a000777m.768.972mgv1a000777m.768.972mgv1a000982m.703.906mgv1a000982m.703.906
Oryza sativaLOC_Os02g28830.1.426.628LOC_Os02g28830.1.426.628LOC_Os01g68680.1.758.959LOC_Os01g68680.1.758.959
Panicum virgatumPavirv00063187m.788.989Pavirv00063187m.788.989
Physcomitrella patensPp1s177_132V6.1.776.975Pp1s177_132V6.1.776.975Pp1s263_4V6.1.778.976Pp1s263_4V6.1.778.976
Phaseolus vulgarisPhvul.007G119800.1.768.970Phvul.007G119800.1.768.970
Picea abiesMA_247226g0010.480.681MA_247226g0010.480.681MA_76964g0020.545.746MA_76964g0020.545.746
Populus trichocarpaPotri.013G051400.7.383.584Potri.013G051400.7.383.584Potri.013G051400.6.524.724Potri.013G051400.6.524.724Potri.013G051400.2.763.963
Potri.013G051400.2.763.963Potri.019G025600.6.390.588Potri.019G025600.6.390.588Potri.019G025600.5.526.724Potri.019G025600.5.526.724
Potri.019G025600.4.594.792Potri.019G025600.4.594.792Potri.019G025600.3.655.853Potri.019G025600.3.655.853Potri.019G025600.2.761.959
Potri.019G025600.2.761.959Potri.019G025600.1.761.959Potri.019G025600.1.761.959Potri.013G051400.1.763.964Potri.013G051400.1.763.964
Potri.013G051400.3.763.961Potri.013G051400.3.763.961Potri.013G051400.4.763.947Potri.013G051400.4.763.947
Prunus persicappa000862m.759.959ppa000862m.759.959
Ricinus communis29680.m001749.759.96029680.m001749.759.96039707.m00001532488.m000020
Setaria italicaSi016197m.790.991Si016197m.790.991Si000265m.652.855Si000265m.652.855
Selaginella moellendorffii143846.655.856143846.655.856
Sorghum bicolorSb04g019560.1.790.998Sb04g019560.1.790.998
Thellungiella halophilaThhalv10019996m.754.959Thhalv10019996m.754.959Thhalv10020000m.729.933Thhalv10020000m.729.933
Vitis viniferaGSVIVT01026359001.766.967GSVIVT01026359001.766.967
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny