CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00020436m
FamilyGT64
Protein PropertiesLength: 344 Molecular Weight: 36595.9 Isoelectric Point: 9.0637
ChromosomeChromosome/Scaffold: 014347 Start: 4986 End: 6017
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT64533200
  TMLLSGYSERRLPLLRAIAGAYAAHPLVLSVVVLWCNPSTPGRVLLRGGGFPPRVTVRRAVSASLNSRFLPRPSDIRTAAVAVADDDVLPDAAALSFAFA
  AWQQQQQQPAAAAGPLVGFFPRSHHLDLARGRWAYTAAQPGRYSMVLTKFMVLGADLLYRYSCSPELAAARAVVDRERNCEDILMNFVAAEESGAGPVLV
  EAGGIRDWGDPRNDVNVGGAGEDGGGMKDVGLSATGGLGHWEKRGACITEFHRLLGRMPLRYSYGKLV
Full Sequence
Protein Sequence     Length: 344     Download
MPPRRSRHFL RVLFLLLVSL AGAGVAHGGA VEDAACAAAN RTDAATLRPD RLTMLLSGYS    60
ERRLPLLRAI AGAYAAHPLV LSVVVLWCNP STPGRVLLRG GGFPPRVTVR RAVSASLNSR    120
FLPRPSDIRT AAVAVADDDV LPDAAALSFA FAAWQQQQQQ PAAAAGPLVG FFPRSHHLDL    180
ARGRWAYTAA QPGRYSMVLT KFMVLGADLL YRYSCSPELA AARAVVDRER NCEDILMNFV    240
AAEESGAGPV LVEAGGIRDW GDPRNDVNVG GAGEDGGGMK DVGLSATGGL GHWEKRGACI    300
TEFHRLLGRM PLRYSYGKLV EAAAGEQGLC SKGGRLVRCD QQE* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam09258Glyco_transf_643.0e-6652320269+
Gene Ontology
GO TermDescription
GO:0016758transferase activity, transferring hexosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN68561.103034123326hypothetical protein [Vitis vinifera]
GenBankEAZ07664.103634233332hypothetical protein OsI_29918 [Oryza sativa Indica Group]
GenBankEAZ43366.103634233332hypothetical protein OsJ_27967 [Oryza sativa Japonica Group]
RefSeqXP_002445871.1013421343hypothetical protein SORBIDRAFT_07g027170 [Sorghum bicolor]
RefSeqXP_002523753.103634341349transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1on8_B9e-235031528275A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1on8_A9e-235031528275A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1on6_B9e-235031528275A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1on6_A9e-235031528275A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1omz_B9e-235031528275A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Transmembrane Domains
StartEnd
931
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR166732271533210
EL480538279743420
AW9320001751683420
GO921129225462650
ES810103273783410
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00173.1Aquca_013_00497.1Aquca_004_00315.3Aquca_004_00315.1Aquca_004_00315.4
Aquca_004_00315.2Aquca_004_00315.5Aquca_009_01030.2Aquca_009_01030.1Aquca_019_00086.1
Aquca_009_01029.1
Arabidopsis lyrata340192908336
Arabidopsis thalianaAT1G80290.2AT1G80290.1AT3G55830.1AT5G04500.1
Brachypodium distachyonBradi3g40395.1Bradi1g34550.1Bradi1g12290.1Bradi1g34550.2Bradi2g18300.1
Brassica rapaBra008483Bra007194Bra009448Bra028787
Carica papayaevm.model.supercontig_488.3evm.model.supercontig_19.204evm.model.supercontig_4.178evm.model.supercontig_128.65
Capsella rubellaCarubv10016140mCarubv10017597mCarubv10003280m
Chlamydomonas reinhardtiiCre12.g508700.t1.2
Citrus clementinaCiclev10010680mCiclev10032067mCiclev10030719m
Citrus sinensisorange1.1g020041morange1.1g045656m
Cucumis sativusCucsa.311230.1Cucsa.368680.1Cucsa.308870.2Cucsa.308870.1
Eucalyptus grandisEucgr.C04240.1Eucgr.G03038.1Eucgr.K00135.1Eucgr.G02723.2Eucgr.G02723.1
Eucgr.K00135.2
Fragaria vescamrna08756.1-v1.0-hybridmrna20928.1-v1.0-hybridmrna09156.1-v1.0-hybridmrna21215.1-v1.0-hybrid
Glycine maxGlyma15g03130.1Glyma14g19550.1Glyma14g06670.1Glyma02g42230.1Glyma14g06670.2
Glyma09g27660.1Glyma16g32650.1Glyma09g27660.2Glyma10g34440.2Glyma20g33120.3
Glyma20g33120.2Glyma14g06670.3
Gossypium raimondiiGorai.008G132700.3Gorai.008G132700.2Gorai.008G132700.1Gorai.012G075900.1Gorai.009G307300.1
Gorai.012G075900.2
Linum usitatissimumLus10020174Lus10040216Lus10028274Lus10031680Lus10037920
Lus10038646Lus10027392
Malus domesticaMDP0000318911MDP0000177948MDP0000292999MDP0000138795MDP0000212600
MDP0000169420
Manihot esculentacassava4.1_010734mcassava4.1_011626mcassava4.1_011602mcassava4.1_011301mcassava4.1_013504m
cassava4.1_010773mcassava4.1_002721mcassava4.1_002024mcassava4.1_012021m
Medicago truncatulaMedtr1g009180.1Medtr5g082110.1
Mimulus guttatusmgv1a026874mmgv1a009961mmgv1a009124mmgv1a023379mmgv1a024929m
Oryza sativaLOC_Os06g49150.1LOC_Os03g48010.1LOC_Os05g46260.1
Panicum virgatumPavirv00045941mPavirv00023272mPavirv00018756mPavirv00050841mPavirv00045066m
Pavirv00036974mPavirv00061476m
Physcomitrella patensPp1s242_74V6.1Pp1s87_187V6.1Pp1s242_81V6.1Pp1s72_263V6.1Pp1s117_57V6.1
Phaseolus vulgarisPhvul.002G252600.1Phvul.008G225700.1Phvul.004G124500.1Phvul.007G144400.1
Picea abiesMA_277070g0010MA_140607g0010MA_30471g0010MA_948289g0010MA_8306453g0010
MA_10432291g0040
Populus trichocarpaPotri.006G278400.1Potri.010G191700.7Potri.010G191700.1Potri.008G065800.1Potri.010G191700.2
Potri.010G191700.5Potri.008G028900.2Potri.008G028900.1Potri.010G232700.3Potri.010G232700.2
Potri.010G232700.1Potri.010G191700.4Potri.010G191700.3Potri.010G191700.8Potri.010G191700.6
Prunus persicappa008992mppa008488mppa007532mppa002869m
Ricinus communis29589.m00129129669.m00081027916.m00015930147.m014149
Setaria italicaSi014019mSi006792mSi034429mSi021307m
Selaginella moellendorffii13310340321881258420395139351
Sorghum bicolorSb07g027170.1Sb10g029290.1Sb01g011790.1Sb09g026940.1
Thellungiella halophilaThhalv10000547mThhalv10010522mThhalv10012710m
Vitis viniferaGSVIVT01032860001GSVIVT01034672001
Volvox carteriVocar20000857m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)