y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00021846m
FamilyGH17
Protein PropertiesLength: 112 Molecular Weight: 11491.5 Isoelectric Point: 9.7793
ChromosomeChromosome/Scaffold: 0145750 Start: 212 End: 1010
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17231039.3e-26
  LGMNWGTQASHPLPPKAVVQVLRDNGIKKVKLFDTDFAAMSALAGSGIEVMAAIPNIMLADLAADAGKAKDWVKRNVKRYD
Full Sequence
Protein Sequence     Length: 112     Download
MAGLAAALLV ALCWAAAPGA AALGMNWGTQ ASHPLPPKAV VQVLRDNGIK KVKLFDTDFA    60
AMSALAGSGI EVMAAIPNIM LADLAADAGK AKDWVKRNVK RYDFDGGVTI K*            120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00925GTP_cyclohydro20.005427736+
pfam00332Glyco_hydro_172.0e-102410279+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG29689.102011118109glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
DDBJBAF20898.23.00004e-4126111107192Os07g0168600 [Oryza sativa Japonica Group]
RefSeqNP_001058984.19.99967e-422611128113Os07g0168600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001130924.11.96182e-442011119110hypothetical protein LOC100192029 [Zea mays]
RefSeqXP_002459388.101011117117hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0.000000000123102180A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A0.00000000423102180A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B0.00000000423102180A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A0.00000000423102180A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1ghs_B0.0000000323102180A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Transmembrane Domains
StartEnd
729
6082
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL86277485241083e-40
BE36155688241112e-39
CX61250988241114e-38
FL33213488241114e-37
CO53105188241115e-37
Orthologous Group
SpeciesID
Arabidopsis lyrata899941
Carica papayaevm.model.supercontig_27.199
Fragaria vescamrna27049.1-v1.0-hybrid
Glycine maxGlyma05g08020.2
Linum usitatissimumLus10020526
Malus domesticaMDP0000908326MDP0000233619MDP0000227501MDP0000631129MDP0000224162
Manihot esculentacassava4.1_024233m
Picea abiesMA_17339g0010MA_8517491g0010MA_1055674g0010MA_6742g0010MA_8478g0010
MA_10437110g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny