| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00021846m |
| Family | GH17 |
| Protein Properties | Length: 112 Molecular Weight: 11491.5 Isoelectric Point: 9.7793 |
| Chromosome | Chromosome/Scaffold: 0145750 Start: 212 End: 1010 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 23 | 103 | 9.3e-26 |
| LGMNWGTQASHPLPPKAVVQVLRDNGIKKVKLFDTDFAAMSALAGSGIEVMAAIPNIMLADLAADAGKAKDWVKRNVKRYD | |||
| Full Sequence |
|---|
| Protein Sequence Length: 112 Download |
| MAGLAAALLV ALCWAAAPGA AALGMNWGTQ ASHPLPPKAV VQVLRDNGIK KVKLFDTDFA 60 AMSALAGSGI EVMAAIPNIM LADLAADAGK AKDWVKRNVK RYDFDGGVTI K* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00925 | GTP_cyclohydro2 | 0.005 | 42 | 77 | 36 | + GTP cyclohydrolase II. GTP cyclohydrolase II catalyzes the first committed step in the biosynthesis of riboflavin. | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-10 | 24 | 102 | 79 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACG29689.1 | 0 | 20 | 111 | 18 | 109 | glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays] |
| DDBJ | BAF20898.2 | 3.00004e-41 | 26 | 111 | 107 | 192 | Os07g0168600 [Oryza sativa Japonica Group] |
| RefSeq | NP_001058984.1 | 9.99967e-42 | 26 | 111 | 28 | 113 | Os07g0168600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001130924.1 | 1.96182e-44 | 20 | 111 | 19 | 110 | hypothetical protein LOC100192029 [Zea mays] |
| RefSeq | XP_002459388.1 | 0 | 10 | 111 | 17 | 117 | hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000001 | 23 | 102 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghr_A | 0.000000004 | 23 | 102 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1aq0_B | 0.000000004 | 23 | 102 | 1 | 80 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 0.000000004 | 23 | 102 | 1 | 80 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1ghs_B | 0.00000003 | 23 | 102 | 1 | 80 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 7 | 29 | |||
| 60 | 82 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 22 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FL862774 | 85 | 24 | 108 | 3e-40 |
| BE361556 | 88 | 24 | 111 | 2e-39 |
| CX612509 | 88 | 24 | 111 | 4e-38 |
| FL332134 | 88 | 24 | 111 | 4e-37 |
| CO531051 | 88 | 24 | 111 | 5e-37 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |