y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00025012m
FamilyGH17
Protein PropertiesLength: 371 Molecular Weight: 40569.8 Isoelectric Point: 5.9516
ChromosomeChromosome/Scaffold: 0359778 Start: 80 End: 1192
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1773250
  IGACYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVGVPNSDLLAFAQYQSNVDTWLKNSILPYYPATMITYITVGAEVTESTV
  NASALVVPAMRNVHTALKKAGLHKKITISSTHSLGILSRSFPPSAGAFNSSYAYFLKPMLEFLVENQAPFMVDLYPYYAYQNSHSNVSLNYALFSPQSQD
  VIDPNTGLVYSNMFDAQVDSIFFALMALNFKTLKIMVTESGWPNKGAAKETGATPDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNENRKPGIG
  SERNWGLFFPDKSSIYSLD
Full Sequence
Protein Sequence     Length: 371     Download
HCQGGKIGAC YGRNADDLPA PDKVAQLIQQ QSIKYVRIYD TNIDVIKAFA NTGVELMVGV    60
PNSDLLAFAQ YQSNVDTWLK NSILPYYPAT MITYITVGAE VTESTVNASA LVVPAMRNVH    120
TALKKAGLHK KITISSTHSL GILSRSFPPS AGAFNSSYAY FLKPMLEFLV ENQAPFMVDL    180
YPYYAYQNSH SNVSLNYALF SPQSQDVIDP NTGLVYSNMF DAQVDSIFFA LMALNFKTLK    240
IMVTESGWPN KGAAKETGAT PDNAQTYNTN LIRHVVNDSG TPAKPGEEID VYIFSLFNEN    300
RKPGIGSERN WGLFFPDKSS IYSLDWTGRG KVDVMTGANI TNANGTWCIA SANASETDLQ    360
NALNWACGPG N                                                         420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53090.000824131881+
pfam07983X80.000234637025+
smart00768X81.0e-634637025+
pfam00332Glyco_hydro_177.0e-1097325319+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28065.10137120390unknown [Zea mays]
GenBankEAZ13481.10137117387hypothetical protein OsJ_03397 [Oryza sativa Japonica Group]
RefSeqNP_001044198.10137117387Os01g0739700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001144992.10137120390hypothetical protein LOC100278152 [Zea mays]
RefSeqXP_002456331.10137121391hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A073261312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_B073263314A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_A073263314A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur7_B073263314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A073263314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EB663214265913550
CO446305278603370
JG8308922381203570
DN216501243963380
EX26497528322840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00065.2.25.344Aquca_091_00065.1.25.344Aquca_004_00728.2.30.350Aquca_004_00728.1.30.350Aquca_005_00012.3.49.368
Aquca_005_00012.2.49.368Aquca_005_00012.1.49.368Aquca_009_00463.1.26.346
Arabidopsis lyrata918818.26.346894267.29.348484077.23.342879428.44.363478745.26.346
913572.27.345
Arabidopsis thalianaAT5G56590.1.26.346AT2G01630.2AT2G01630.1.23.342AT3G13560.3.26.346AT3G13560.2.26.346
AT3G13560.1.26.346AT1G66250.1.32.350AT1G11820.2.44.363AT1G11820.1AT4G29360.2.27.345
AT4G29360.1.27.345
Brachypodium distachyonBradi1g69610.1.25.345Bradi1g23640.1.34.355Bradi1g26510.1.46.373Bradi2g49330.2.27.344Bradi2g49330.1.27.344
Brassica rapaBra002805.12.332Bra027421.26.345Bra026644.23.342Bra039757.32.351Bra016812.48.367
Bra010330.16.334Bra011100.28.316
Carica papayaevm.model.supercontig_116.58.23.342evm.model.supercontig_2.222.14.333evm.model.supercontig_152.27.47.366
Capsella rubellaCarubv10026261m.28.348Carubv10019942m.166.485Carubv10019481m.23.342Carubv10013514m.26.346Carubv10007158m.27.345
Citrus clementinaCiclev10011549m.23.342Ciclev10014990m.24.343Ciclev10015028m.26.347Ciclev10015027m.26.347
Citrus sinensisorange1.1g010931m.23.342orange1.1g010833m.24.343orange1.1g010394m.31.350orange1.1g011132m.26.347orange1.1g011131m.26.347
Cucumis sativusCucsa.006230.1.30.349Cucsa.029930.3.23.342Cucsa.029930.1.23.342Cucsa.085740.1.42.361Cucsa.355790.4.25.345
Cucsa.355790.3.25.345Cucsa.355790.2.25.345Cucsa.355790.1.25.345Cucsa.153140.1.29.348
Eucalyptus grandisEucgr.F02860.2.27.346Eucgr.F02860.1.27.346Eucgr.G02118.1.24.343Eucgr.D01339.2.43.362Eucgr.D01339.1.43.362
Eucgr.E04042.1.55.374Eucgr.B03614.1.26.346
Fragaria vescamrna30530.1-v1.0-hybrid.32.351mrna19637.1-v1.0-hybrid.233.552
Glycine maxGlyma02g07730.1.23.342Glyma14g39510.3.75.394Glyma14g39510.2.75.394Glyma11g33650.1.23.342Glyma02g41190.1.24.343
Glyma05g34930.2.22.341Glyma18g04560.1.23.342Glyma08g04780.2.27.346Glyma16g26800.5.32.292Glyma16g26800.4.32.292
Glyma16g26800.3.32.292Glyma07g39140.5.43.362Glyma07g39140.4.43.362Glyma07g39140.3.43.362Glyma17g01601.2.66.385
Glyma17g01601.1.66.385Glyma14g16630.2.29.350Glyma17g29820.4.26.347Glyma17g29820.3.26.347Glyma17g29820.2.26.347
Glyma08g12020.1.26.347Glyma05g28870.1.26.347Glyma01g05991.1Glyma16g26800.7.33.138Glyma16g26800.7.33.138
Glyma16g26800.6.33.138Glyma16g26800.6.33.138
Gossypium raimondiiGorai.001G204900.2.125.444Gorai.001G204900.1.125.444Gorai.005G159100.2.23.342Gorai.005G159100.1.23.342Gorai.002G174100.2.23.342
Gorai.002G174100.1.23.342Gorai.004G064200.1.23.342Gorai.009G179400.3.46.365Gorai.009G179400.2.46.365Gorai.009G179400.1.46.365
Gorai.004G094500.1.25.345Gorai.010G126400.5.26.347Gorai.010G126400.2.26.347Gorai.010G126400.1.26.347
Linum usitatissimumLus10013465.24.343Lus10002295.34.354Lus10004044.34.354Lus10031456.44.370Lus10039179.46.365
Lus10034987.31.294
Malus domesticaMDP0000251002.284.604MDP0000271262.26.346MDP0000319911.279.599MDP0000120761.26.346
Manihot esculentacassava4.1_005970m.32.351cassava4.1_006180m.23.342cassava4.1_021465m.50.369cassava4.1_030523m.24.341cassava4.1_006189m.26.346
Medicago truncatulaMedtr5g078200.1.23.342Medtr3g065460.1.24.344Medtr4g132280.1.45.364Medtr8g085720.1.26.346Medtr3g083580.1.26.348
Medtr8g102340.1.54.312Medtr6g090590.1.61.310
Mimulus guttatusmgv1a004953m.31.350mgv1a005128m.23.342mgv1a006342m.31.350mgv1a004989m.25.345mgv1a005031m.28.346
Oryza sativaLOC_Os03g12140.1.26.346LOC_Os07g38930.5.31.352LOC_Os07g38930.4.31.352LOC_Os07g38930.3.31.352LOC_Os07g38930.2.31.352
LOC_Os07g38930.1.31.352LOC_Os07g32600.2.45.374LOC_Os07g32600.1.45.374LOC_Os01g53750.1.23.341
Panicum virgatumPavirv00023750m.26.346Pavirv00010764m.25.346Pavirv00062581m.25.346Pavirv00014937m.41.373Pavirv00068281m.41.373
Pavirv00058553m.13.331
Physcomitrella patensPp1s98_31V6.1.28.346Pp1s1_72V6.2.26.344Pp1s1_72V6.1.26.344Pp1s138_47V6.2.38.358Pp1s138_47V6.1.38.358
Pp1s85_128V6.1.32.350
Phaseolus vulgarisPhvul.001G230000.1.23.343Phvul.004G077000.1.22.341Phvul.008G236700.1.23.342Phvul.002G319500.2Phvul.002G319500.1.25.344
Phvul.003G079900.1.44.363Phvul.001G056400.1.29.350Phvul.002G236300.2.26.347Phvul.002G236300.1.26.347Phvul.006G149100.2.35.354
Phvul.006G149100.1.35.354
Picea abiesMA_10436589g0010.77.396MA_9241891g0010.84.403
Populus trichocarpaPotri.004G086400.3.17.336Potri.004G086400.1.31.350Potri.017G130200.2.31.350Potri.017G130200.1.31.350Potri.010G108500.1.23.342
Potri.008G133200.1.23.342Potri.004G010500.2.45.364Potri.004G010500.1.45.364Potri.011G006100.1.45.364Potri.003G218500.4.22.341
Potri.003G218500.3Potri.003G218500.2.22.341Potri.003G218500.1.22.341Potri.001G006500.2.22.341Potri.001G006500.1.22.341
Potri.018G068600.2Potri.018G068600.1.27.345
Prunus persicappa004534m.31.350ppa003984m.52.371ppa004732m.26.346
Ricinus communis29692.m000518.23.34229005.m000260.34.35329842.m003579.50.369
Setaria italicaSi029628m.25.346Si029448m.39.370Si000583m.196.514Si000582m.196.514
Selaginella moellendorffii442025.18.33675479.10.330402967.20.337
Sorghum bicolorSb01g042560.1.26.346Sb02g037380.1.25.346Sb03g034100.1.27.345
Thellungiella halophilaThhalv10013309m.26.346Thhalv10020572m.23.342Thhalv10020571m.23.342Thhalv10020570m.23.342Thhalv10004013m.39.358
Thhalv10018427m.35.354Thhalv10006713m.49.368Thhalv10024870m.27.345
Vitis viniferaGSVIVT01030716001.22.341GSVIVT01011682001.23.342GSVIVT01012711001.47.366GSVIVT01015282001.26.343
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)