Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00025617m |
Family | GT1 |
Protein Properties | Length: 165 Molecular Weight: 18565.2 Isoelectric Point: 8.1372 |
Chromosome | Chromosome/Scaffold: 0242658 Start: 896 End: 1905 |
Description | Uridine diphosphate glycosyltransferase 74E2 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 5 | 137 | 1.4e-33 |
NSGKPFLWVVRANEEHKLSDELRNKCEQHGLIVSWCNQLDVLAHKATGCFFTHCGWNSTLEAIVNGVPMVAIPHWADQPTISKYMESVWGLGVRVRKDEK GLVTRDEVERCIKEVMDGDRKDKYRTNATMWMQ |
Full Sequence |
---|
Protein Sequence Length: 165 Download |
MGCSNSGKPF LWVVRANEEH KLSDELRNKC EQHGLIVSWC NQLDVLAHKA TGCFFTHCGW 60 NSTLEAIVNG VPMVAIPHWA DQPTISKYME SVWGLGVRVR KDEKGLVTRD EVERCIKEVM 120 DGDRKDKYRT NATMWMQKAK EAMQKGGSSD KNIAEFASKY SSSH* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02210 | PLN02210 | 4.0e-39 | 5 | 158 | 156 | + UDP-glucosyl transferase | ||
PLN02448 | PLN02448 | 1.0e-46 | 2 | 156 | 159 | + UDP-glycosyltransferase family protein | ||
PLN02555 | PLN02555 | 2.0e-50 | 2 | 159 | 166 | + limonoid glucosyltransferase | ||
PLN02173 | PLN02173 | 1.0e-50 | 10 | 162 | 155 | + UDP-glucosyl transferase family protein | ||
PLN02152 | PLN02152 | 1.0e-52 | 7 | 156 | 162 | + indole-3-acetate beta-glucosyltransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG40098.1 | 0 | 2 | 163 | 312 | 473 | indole-3-acetate beta-glucosyltransferase [Zea mays] |
RefSeq | NP_001052244.1 | 0 | 2 | 162 | 306 | 466 | Os04g0206600 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001142157.1 | 0 | 2 | 163 | 75 | 236 | hypothetical protein LOC100274322 [Zea mays] |
RefSeq | NP_001151399.1 | 0 | 2 | 163 | 312 | 473 | indole-3-acetate beta-glucosyltransferase [Zea mays] |
RefSeq | XP_002447506.1 | 0 | 2 | 163 | 310 | 471 | hypothetical protein SORBIDRAFT_06g002180 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 1e-29 | 2 | 153 | 319 | 470 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c9z_A | 3e-25 | 9 | 153 | 302 | 443 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c1z_A | 3e-25 | 9 | 153 | 302 | 443 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c1x_A | 3e-25 | 9 | 153 | 302 | 443 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vg8_A | 8e-25 | 1 | 162 | 291 | 469 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
crocetin esters biosynthesis | RXN-8471 | EC-2.4.1.271 | crocetin glucosyltransferase |
crocetin esters biosynthesis | RXN-8473 | EC-2.4.1.271 | crocetin glucosyltransferase |
crocetin esters biosynthesis | RXN-8475 | EC-2.4.1.271 | crocetin glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JG957951 | 163 | 2 | 164 | 0 |
JG946365 | 163 | 2 | 164 | 0 |
GD009167 | 164 | 2 | 165 | 0 |
JG890429 | 163 | 2 | 164 | 0 |
JG911926 | 163 | 2 | 164 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|