y
Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00028432m |
Family | GH1 |
Protein Properties | Length: 160 Molecular Weight: 18668.2 Isoelectric Point: 9.7811 |
Chromosome | Chromosome/Scaffold: 029663 Start: 4848 End: 6418 |
Description | B-S glucosidase 44 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 21 | 155 | 0 |
ESVNERNGKPIGPRANSNWLYIVPTGMYGCVNYIKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYIRQLKRAIDHGANVAGYFAWSLLDNF EWRLGYSAKFGIVYVDFNTLERHPKASAYWFRDML |
Full Sequence |
---|
Protein Sequence Length: 160 Download |
MKGQKLLQQT PTSYSDDWQV ESVNERNGKP IGPRANSNWL YIVPTGMYGC VNYIKEKYGN 60 PTVYITENGM DQPGNLTRDQ YLRDVTRVRF YKSYIRQLKR AIDHGANVAG YFAWSLLDNF 120 EWRLGYSAKF GIVYVDFNTL ERHPKASAYW FRDMLIRKN* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02998 | PLN02998 | 1.0e-24 | 53 | 155 | 105 | + beta-glucosidase | ||
COG2723 | BglB | 2.0e-29 | 20 | 154 | 148 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
PRK13511 | PRK13511 | 4.0e-33 | 15 | 152 | 139 | + 6-phospho-beta-galactosidase; Provisional | ||
TIGR03356 | BGL | 1.0e-42 | 10 | 151 | 142 | + beta-galactosidase. | ||
pfam00232 | Glyco_hydro_1 | 7.0e-43 | 29 | 159 | 132 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2RGL | 0 | 1 | 155 | 325 | 479 | A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA- Glucosidase |
PDB | 3F4V | 0 | 1 | 155 | 325 | 479 | A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA-Glucosidase |
GenBank | ABF98424.1 | 0 | 1 | 155 | 244 | 398 | Glycosyl hydrolase family 1 protein, expressed [Oryza sativa (japonica cultivar-group)] |
GenBank | ABR25480.1 | 0 | 1 | 155 | 8 | 162 | non-cyanogenic beta-glucosidase precursor [Oryza sativa Indica Group] |
RefSeq | NP_001142124.1 | 0 | 1 | 155 | 345 | 499 | hypothetical protein LOC100274288 [Zea mays] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3f5l_B | 0 | 1 | 155 | 325 | 479 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 3f5l_A | 0 | 1 | 155 | 325 | 479 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 3f5k_B | 0 | 1 | 155 | 325 | 479 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 3f5k_A | 0 | 1 | 155 | 325 | 479 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 3f5j_B | 0 | 1 | 155 | 325 | 479 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE643471 | 160 | 1 | 160 | 0 |
FL971972 | 160 | 1 | 160 | 0 |
JG834863 | 160 | 1 | 160 | 0 |
FL917919 | 160 | 1 | 160 | 0 |
FL928735 | 160 | 1 | 160 | 0 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Fragaria vesca | mrna19576.1-v1.0-hybrid | ||||
Panicum virgatum | Pavirv00028433m | Pavirv00056463m | |||
Sorghum bicolor | Sb06g022470.1 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|