y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00029831m
FamilyCBM43
Protein PropertiesLength: 470 Molecular Weight: 49252.9 Isoelectric Point: 6.7699
ChromosomeChromosome/Scaffold: 007622 Start: 9351 End: 13607
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433854661.2e-33
  WCVAKAGADATTLQNNINYACGFVDCKPIQSGGGCFDPNNVQSHASFVMNTYYQANGRHDSDCDFKGTGMVISKDPSYGGCK
GH17283500
  IGVNYGANADNLPSPAAVATFLATKTTVNRVKLFDANPAFLDAFAANAPAISIAVSIPNSALPAFADRAAGLDAARGWVRDNLAAHVAAGANVTLLLAGN
  EILGPTVVPDLVVALLPAMRRLHQALQLEGLPQVRVTTPHYLGILAPSDGIPSNARFRPGLDAKVLAPMLRFHNDTGSPLMVNAYPYFSYNAQNLNYAVF
  RPNAGVYDPATKLNYTSMFDAQMDAIYTAMKKLGFGDVQIAVGEAGWPTQAEPGQVGVGPEEARDFNAGMIRVCSGGKGTPLMPGRTFETYIFSLFDENQ
  KPGPIAERNFGIFNPDFTPKYDL
Full Sequence
Protein Sequence     Length: 470     Download
MLPLLLFLLA AAAASGPAAA QGLPPLPIGV NYGANADNLP SPAAVATFLA TKTTVNRVKL    60
FDANPAFLDA FAANAPAISI AVSIPNSALP AFADRAAGLD AARGWVRDNL AAHVAAGANV    120
TLLLAGNEIL GPTVVPDLVV ALLPAMRRLH QALQLEGLPQ VRVTTPHYLG ILAPSDGIPS    180
NARFRPGLDA KVLAPMLRFH NDTGSPLMVN AYPYFSYNAQ NLNYAVFRPN AGVYDPATKL    240
NYTSMFDAQM DAIYTAMKKL GFGDVQIAVG EAGWPTQAEP GQVGVGPEEA RDFNAGMIRV    300
CSGGKGTPLM PGRTFETYIF SLFDENQKPG PIAERNFGIF NPDFTPKYDL GLLRDGSSAS    360
ASPNPSPNPS PKPSPNPSPS GGGKWCVAKA GADATTLQNN INYACGFVDC KPIQSGGGCF    420
DPNNVQSHAS FVMNTYYQAN GRHDSDCDFK GTGMVISKDP SYGGCKYVS*               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X82.0e-2438545476+
smart00768X83.0e-4138546784+
pfam00332Glyco_hydro_173.0e-5828350328+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX95270.102346931472glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-3)-beta-glucan endohydrolase) ((1-3)-beta-glucanase) (beta-1,3-endoglucanase) [Oryza sativa Japonica Group]
GenBankACF79258.101646713457unknown [Zea mays]
GenBankACG36515.101946718458glucan endo-1,3-beta-glucosidase precursor [Zea mays]
RefSeqNP_001141385.101646713457hypothetical protein LOC100273476 [Zea mays]
RefSeqXP_002451320.101246918467hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B0273522314A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB3ur8_A0273522314A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB3ur7_B0273522314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A0273522314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1ghs_B0283501304A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR7990902971284240
FL7537412781914680
DV5156812801764550
FE5997532442204630
FE6306432412304700
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00316.1.375.457Aquca_010_00473.1.377.458Aquca_037_00225.1.384.465Aquca_022_00080.1Aquca_027_00361.1.370.452
Aquca_022_00111.1Aquca_003_00044.1.385.467Aquca_002_00835.1Aquca_010_00473.2.377.449
Arabidopsis lyrata483480876708489799889285316754
347193918444918445332548.93.174332548.93.174
921012485970.366.448915838483478321648.455.536
321648.455.536332548.26.90332548.26.90901946321648.356.437
321648.356.437894388497543496508351455.358.440
894393919614333412350051480794.366.444
919353894381894389920460894710
471542904630890098
Arabidopsis thalianaAT4G34480.1.364.445AT2G16230.1.366.447AT2G43670.1AT1G78520.1AT4G09090.1
AT4G09462.1AT4G09467.1AT4G09464.1AT4G09465.1AT3G28250.1
AT4G09466.1AT5G53610.1AT5G53600.1AT2G43660.2AT2G43660.1
AT5G63225.1AT4G16165.1AT5G63230.1AT2G39640.1.460.541AT2G39640.1.460.541
AT2G39640.1.359.440AT2G39640.1.359.440AT1G66870.1AT5G63240.1AT5G63250.1
AT3G55430.1.366.448AT5G24318.1.372.454AT1G66852.1AT1G18650.1AT5G24318.2.372.450
AT5G61130.1AT1G66855.1AT5G08000.1AT1G69295.1AT2G03505.1
AT1G13830.1AT1G26450.1
Brachypodium distachyonBradi1g12810.1.375.457Bradi2g08580.1Bradi3g14430.3Bradi3g14430.2Bradi3g14430.1
Bradi4g09230.1.390.471Bradi1g08230.1Bradi5g26467.1.387.474Bradi4g09230.2.390.468Bradi1g16230.1
Brassica rapaBra017659.418.499Bra011537.369.450Bra036510.361.443Bra014082Bra003212.365.448
Bra007161.369.452Bra014747.367.449Bra007162.368.447Bra025675Bra035043
Bra038618Bra039998Bra036081Bra029334Bra035941
Bra016548Bra012981Bra009313Bra039852.370.448Bra005028.356.435
Bra012458Bra016724Bra038314Bra026880Bra004003
Bra004369Bra025116Bra019700Bra026879Bra026878
Carica papayaevm.model.supercontig_36.69.377.459evm.model.supercontig_62.143.362.444evm.model.supercontig_26.161.352.430evm.model.supercontig_81.143.366.448evm.model.supercontig_3.108.376.459
evm.model.supercontig_1272.1evm.model.supercontig_1.407.360.441evm.model.supercontig_94.45evm.model.supercontig_1.118
Capsella rubellaCarubv10005030m.248.329Carubv10015799m.362.443Carubv10021581mCarubv10025243mCarubv10017225m.370.453
Carubv10024804mCarubv10003182mCarubv10024539mCarubv10002428mCarubv10028110m
Carubv10002725mCarubv10003588mCarubv10021377mCarubv10025630mCarubv10022451m
Carubv10021358mCarubv10027463mCarubv10025141m.451.533Carubv10025141m.451.533Carubv10000922m.374.456
Carubv10021806mCarubv10027366mCarubv10021306mCarubv10027167mCarubv10002008m
Carubv10025141m.355.437Carubv10025141m.355.437Carubv10012483mCarubv10012551mCarubv10017928m
Carubv10020897mCarubv10010353m
Citrus clementinaCiclev10001687m.262.344Ciclev10028372m.379.460Ciclev10003630m.338.419Ciclev10022784mCiclev10022921m
Ciclev10017518mCiclev10017622mCiclev10028241m.382.463Ciclev10017969mCiclev10017995m
Ciclev10017980mCiclev10020075m.377.459Ciclev10033472m.365.446Ciclev10032483m
Citrus sinensisorange1.1g011390m.400.482orange1.1g019362m.254.335orange1.1g012262m.379.460orange1.1g040787m.338.419orange1.1g032550m
orange1.1g034483morange1.1g033263morange1.1g037583m.382.463orange1.1g047957m.36.117orange1.1g047957m.36.117
orange1.1g048472morange1.1g047957m.133.210orange1.1g047957m.133.210orange1.1g039834morange1.1g043079m.377.459
orange1.1g038452m.354.435orange1.1g029582m
Cucumis sativusCucsa.109660.1.376.457Cucsa.342270.1.390.472Cucsa.117900.1.363.445Cucsa.058100.1Cucsa.165390.1.363.440
Cucsa.198190.2Cucsa.198190.1Cucsa.202330.1.409.491Cucsa.327840.1Cucsa.284540.1
Eucalyptus grandisEucgr.G00445.1.382.463Eucgr.F01563.3.264.345Eucgr.F01563.2.386.467Eucgr.F03575.1.378.460Eucgr.F01563.1.386.463
Eucgr.F01381.1Eucgr.A01020.2Eucgr.A01020.3Eucgr.A01020.1Eucgr.B02367.1.375.456
Eucgr.B02367.2.375.455Eucgr.J00013.1.367.448Eucgr.A01445.1.391.472Eucgr.G02452.1Eucgr.B03157.1
Fragaria vescamrna20426.1-v1.0-hybrid.475.557mrna31503.1-v1.0-hybrid.383.461mrna30557.1-v1.0-hybridmrna30558.1-v1.0-hybrid.40.123mrna30558.1-v1.0-hybrid.40.123
mrna26603.1-v1.0-hybrid.363.444mrna30558.1-v1.0-hybrid.140.221mrna30558.1-v1.0-hybrid.140.221mrna30559.1-v1.0-hybrid.136.216mrna30559.1-v1.0-hybrid.136.216
mrna26607.1-v1.0-hybrid.410.490mrna15136.1-v1.0-hybrid.392.474mrna22973.1-v1.0-hybridmrna26605.1-v1.0-hybridmrna14081.1-v1.0-hybrid.385.466
mrna12825.1-v1.0-hybrid.381.456mrna16853.1-v1.0-hybridmrna26604.1-v1.0-hybrid.26.107mrna26604.1-v1.0-hybrid.26.107mrna26604.1-v1.0-hybrid.26.107
Glycine maxGlyma12g04800.2.346.428Glyma12g04800.1.255.337Glyma06g01500.3.231.312Glyma06g01500.2.371.452Glyma06g01500.1.371.452
Glyma04g01450.1.371.452Glyma14g08200.1.396.477Glyma13g33720.1Glyma15g39060.1Glyma05g25840.1
Glyma06g21982.1Glyma18g52860.1.371.453Glyma18g52860.2.371.450Glyma17g08570.1Glyma05g00470.2
Glyma05g00470.1Glyma20g03100.1Glyma02g12950.2Glyma02g12950.1Glyma01g07100.1
Glyma07g35230.1Glyma08g11825.1
Gossypium raimondiiGorai.002G114200.1.369.451Gorai.005G243100.4.235.316Gorai.005G243100.2.368.449Gorai.006G090600.1.360.441Gorai.005G243100.1.368.446
Gorai.008G135800.2Gorai.008G135800.1Gorai.013G263800.1.384.466Gorai.009G360300.1Gorai.002G044300.2
Gorai.002G044300.1Gorai.011G041500.1Gorai.009G010800.1.359.440Gorai.003G101000.1Gorai.010G239200.1.152.233
Gorai.010G239200.1.152.233Gorai.010G239200.1.55.136Gorai.010G239200.1.55.136Gorai.009G202900.2.384.465Gorai.009G202900.1.384.462
Gorai.006G202300.1.426.508Gorai.011G261100.1Gorai.011G260900.1Gorai.013G093600.3Gorai.013G093600.2
Gorai.013G093600.1Gorai.008G177700.1Gorai.011G261200.1Gorai.009G326600.2Gorai.009G326600.1
Linum usitatissimumLus10040461.376.458Lus10023576.374.456Lus10012080.395.475Lus10016032.390.469Lus10021157
Lus10040522Lus10042492Lus10026175Lus10040294.362.444Lus10005166.448.526
Lus10008865.358.440Lus10004962.370.452Lus10005459.235.317Lus10016539.377.459Lus10040808.378.460
Lus10034690Lus10021619Lus10023245.361.443Lus10039923Lus10032719.266.346
Lus10037071Lus10036914Lus10026662Lus10004650
Malus domesticaMDP0000146863.371.453MDP0000321387.394.472MDP0000179206.339.417MDP0000279434MDP0000131669
MDP0000754160.393.474MDP0000543964.370.451MDP0000676131.386.467MDP0000379414MDP0000136027
MDP0000399053.489.567MDP0000289320MDP0000323489MDP0000323490MDP0000163137
MDP0000153001
Manihot esculentacassava4.1_007302m.370.451cassava4.1_007509m.362.443cassava4.1_011788m.238.320cassava4.1_007157m.375.457cassava4.1_033885m
cassava4.1_006146m.374.456cassava4.1_007570m.364.446cassava4.1_028471mcassava4.1_021354mcassava4.1_028386m
cassava4.1_022539mcassava4.1_030302m.372.454cassava4.1_028382m.397.474cassava4.1_016458mcassava4.1_016746m
cassava4.1_016034mcassava4.1_017159m
Medicago truncatulaMedtr4g069940.1.375.457Medtr8g085420.1Medtr3g116510.2.371.453Medtr3g116510.1.389.471Medtr7g026340.1.365.446
Medtr4g083500.1.383.465Medtr4g083070.2Medtr4g083070.1Medtr5g044530.1
Mimulus guttatusmgv1a006001m.373.454mgv1a016668mmgv1a006105m.372.454mgv1a006294m.364.446mgv1a020101m
mgv1a020042mmgv1a013571m
Oryza sativaLOC_Os03g46660.1.430.512LOC_Os01g14140.1LOC_Os04g58555.1LOC_Os08g04140.2LOC_Os08g04140.1
LOC_Os11g47820.2.347.428LOC_Os11g47820.1.388.469
Panicum virgatumPavirv00002759mPavirv00067089m.206.286Pavirv00065452mPavirv00031319mPavirv00045086m
Pavirv00040284mPavirv00052940mPavirv00029831m.385.466Pavirv00056154mPavirv00056153m
Pavirv00066921mPavirv00066920mPavirv00066919mPavirv00062317mPavirv00017870m
Pavirv00017869mPavirv00044154m.268.338Pavirv00042842mPavirv00036341m
Physcomitrella patensPp1s51_57V6.1.428.510Pp1s150_19V6.1.431.513Pp1s1_72V6.2.361.444Pp1s1_72V6.1.361.444
Phaseolus vulgarisPhvul.011G045800.1.370.452Phvul.001G014900.1.385.466Phvul.009G024000.1.369.450Phvul.005G064400.1Phvul.003G185300.1
Phvul.002G196100.1Phvul.008G010600.1.360.442Phvul.002G099500.1.381.463Phvul.009G192000.1Phvul.003G043000.1
Phvul.002G102400.1
Picea abiesMA_67006g0010.395.473MA_11716g0010.394.475MA_83329g0010.388.469MA_9501830g0010MA_8038g0010.405.487
MA_10429655g0010MA_279076g0010
Populus trichocarpaPotri.008G056000.1.370.451Potri.002G007300.1.373.456Potri.004G153800.1.368.447Potri.009G115400.5.232.313Potri.009G115400.2.364.445
Potri.002G261800.2.401.482Potri.002G261800.1.401.482Potri.009G115400.1.364.442Potri.008G055900.1.364.446Potri.014G114500.1
Potri.011G099000.1Potri.005G253900.1.317.395Potri.001G351600.1Potri.001G380600.1Potri.011G100300.1
Potri.008G055900.2.364.442Potri.010G158900.3Potri.010G158900.2Potri.010G158900.1Potri.011G099600.1
Potri.011G099900.1Potri.001G240000.1.370.451Potri.001G240000.2.370.448Potri.012G017800.2.376.459Potri.012G017800.1.379.462
Potri.012G065700.1Potri.015G057800.1Potri.015G010100.1.374.450Potri.008G095300.1
Prunus persicappa005142m.388.470ppa005375m.376.457ppa013618mppa017757mppa015282m
ppa027174mppa015278mppa004320m.396.477ppa005160m.390.471ppa004976m.395.476
ppa023079m.387.469ppa011545m
Ricinus communis30190.m010891.372.45330170.m013711.371.45329989.m00042929977.m000251.361.44330003.m000340.373.454
30170.m014027.373.45430003.m000339.362.44029693.m00203030076.m00457529693.m002049.32.113
29693.m002049.32.11329693.m002049.134.21429693.m002049.134.21429693.m002048.114.19129693.m002048.114.191
30138.m00398129753.m000250.388.46630174.m009116
Setaria italicaSi035582m.373.455Si026317m.389.470Si021971m.381.463Si035430m.380.460Si012108m
Si014645mSi003126mSi037676m
Selaginella moellendorffii115863438073.409.49119025437861.333.41694863.374.453
69045496605975273476.373.45238965
389693896869709
Sorghum bicolorSb01g012380.1.386.468Sb06g033250.1.379.462Sb05g027690.1.383.464Sb01g007670.1Sb03g000270.1
Sb06g020000.1Sb07g002710.1
Thellungiella halophilaThhalv10024968m.370.451Thhalv10022641m.383.464Thhalv10011991mThhalv10019333mThhalv10001721m
Thhalv10010363m.372.455Thhalv10008839mThhalv10004907mThhalv10005328mThhalv10012146m
Thhalv10017796mThhalv10017897m.358.439Thhalv10005350mThhalv10019456mThhalv10005544m
Thhalv10004182m.379.456Thhalv10014742mThhalv10005040mThhalv10008841mThhalv10019091m
Thhalv10008701m
Vitis viniferaGSVIVT01009700001.377.458GSVIVT01031959001.404.485GSVIVT01013401001.398.480GSVIVT01016553001.321.403GSVIVT01014068001
GSVIVT01007873001GSVIVT01021412001GSVIVT01038583001.375.457GSVIVT01012212001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)