CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00029899m
FamilyGT28
Protein PropertiesLength: 476 Molecular Weight: 52735.1 Isoelectric Point: 9.3253
ChromosomeChromosome/Scaffold: 006359 Start: 6872 End: 11800
Descriptionmonogalactosyldiacylglycerol synthase 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282844425.6e-31
  VLLMGGGEGMGPVEETARALGEELYDDERRRPIGQIVVICGRNRALRSSLQSLTWKVPVKIRGFEKQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN
  DFIPGQEVGNVPYVVDNGAGVFFKDPRKVANQVARWFSVDVDALKRYSRNALKLAQPEA
Full Sequence
Protein Sequence     Length: 476     Download
MVISVGTGRR SIRDAVLGGG VQGGGGRQLY YRPPLRCGLY DGSVVGGQSV DGLAAALSEE    60
AAADPVRIPD GAAKAKNVLI LMSDTGGGHR ASAEALRDAF RIEFGDAYQV LVRDLGKEYG    120
GWPLNDMERS YKFMIRHVRL WKVAFHGTSP RWVHGVYLAA LAYLYGNEVV AGLMKYKPDM    180
IISVHPLMQH IPLWVLKWQS LQRKVPFFTV VTDLNTCHPT WFHYGVTKCY CPSAEVANRA    240
LLRGLQTSQV RVFGLPVRPS FCRAELDKDE MRKELELDPN LPAVLLMGGG EGMGPVEETA    300
RALGEELYDD ERRRPIGQIV VICGRNRALR SSLQSLTWKV PVKIRGFEKQ MEKWMGACDC    360
IITKAGPGTI AEALIRGLPI ILNDFIPGQE VGNVPYVVDN GAGVFFKDPR KVANQVARWF    420
SVDVDALKRY SRNALKLAQP EAVFDIVKDI HKLQQHSAAL TRIPYFLTSS FLYHI*        480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG5.0e-2379448397+
PRK13608PRK136086.0e-33165458298+
PRK13609PRK136093.0e-4174462397+
pfam06925MGDG_synth4.0e-6889257169+
PLN02605PLN02605078456381+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtA2YTP9014751469MGDG2_ORYSI RecName: Full=Probable monogalactosyldiacylglycerol synthase 2, chloroplastic; Short=OsMGD2; Flags: Precursor
GenBankAAQ56578.1014751505putative monogalactosyldiacylglycerol synthase [Oryza sativa Japonica Group]
RefSeqNP_001061487.10724755408Os08g0299400 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ6UTZ2014751469MGDG2_ORYSJ RecName: Full=Probable monogalactosyldiacylglycerol synthase 2, chloroplastic; Short=OsMGD2; Flags: Precursor
RefSeqXP_002444782.1014751479hypothetical protein SORBIDRAFT_07g027910 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8450523001734720
DT3392792961364310
CJ6720792751143880
EX5297593081284350
HO604323398674530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00008414m
Pavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)