Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00030091m |
Family | CE8 |
Protein Properties | Length: 98 Molecular Weight: 10602.5 Isoelectric Point: 3.8739 |
Chromosome | Chromosome/Scaffold: 005942 Start: 2 End: 295 |
Description | Plant invertase/pectin methylesterase inhibitor superfamily |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE8 | 1 | 81 | 1.5e-24 |
GRPWGAYARAAVMDSYLGPIVDREGWAEWPGAEPGRGDTVFFGEYGNGGPGAGTEGRVRWAGVRQMDYDEAAQFAVENFIY |
Full Sequence |
---|
Protein Sequence Length: 98 Download |
GRPWGAYARA AVMDSYLGPI VDREGWAEWP GAEPGRGDTV FFGEYGNGGP GAGTEGRVRW 60 AGVRQMDYDE AAQFAVENFI YGDEWLGATS FPYDDDV* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03043 | PLN03043 | 6.0e-26 | 1 | 93 | 94 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
pfam01095 | Pectinesterase | 3.0e-27 | 1 | 83 | 84 | + Pectinesterase. | ||
PLN02468 | PLN02468 | 8.0e-28 | 1 | 96 | 97 | + putative pectinesterase/pectinesterase inhibitor | ||
PLN02314 | PLN02314 | 2.0e-31 | 1 | 95 | 97 | + pectinesterase | ||
PLN02416 | PLN02416 | 5.0e-36 | 1 | 97 | 97 | + probable pectinesterase/pectinesterase inhibitor |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005618 | cell wall |
GO:0030599 | pectinesterase activity |
GO:0042545 | cell wall modification |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACN32107.1 | 0 | 13 | 97 | 1 | 85 | unknown [Zea mays] |
DDBJ | BAH56489.1 | 6e-29 | 1 | 97 | 449 | 543 | pectin methylesterase 1 [Prunus persica] |
GenBank | EEE65248.1 | 2e-28 | 29 | 97 | 482 | 550 | hypothetical protein OsJ_20428 [Oryza sativa Japonica Group] |
RefSeq | NP_001057041.1 | 1.4013e-45 | 1 | 97 | 489 | 585 | Os06g0193200 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002436630.1 | 0 | 1 | 97 | 510 | 606 | hypothetical protein SORBIDRAFT_10g006230 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1xg2_A | 8e-19 | 1 | 95 | 220 | 313 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 1gq8_A | 6e-17 | 1 | 94 | 224 | 316 | A Chain A, Pectin Methylesterase From Carrot |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL836826 | 98 | 1 | 98 | 0 |
FE611665 | 98 | 1 | 98 | 0 |
FL836825 | 98 | 1 | 98 | 0 |
FE611664 | 98 | 1 | 98 | 0 |
CA147464 | 98 | 1 | 98 | 0 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Brachypodium distachyon | Bradi1g46720.1 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|