Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00030437m |
Family | GH19 |
Protein Properties | Length: 100 Molecular Weight: 10140.3 Isoelectric Point: 8.3275 |
Chromosome | Chromosome/Scaffold: 007316 Start: 11663 End: 12610 |
Description | basic chitinase |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 1 | 75 | 6.7e-28 |
MTARGNKPSCHAVITGQWAPTAADRAAGRGAPGYGVVTNVINGGLECGHGADPRVADRIGFYKRYCDVFRIGYGS |
Full Sequence |
---|
Protein Sequence Length: 100 Download |
MTARGNKPSC HAVITGQWAP TAADRAAGRG APGYGVVTNV INGGLECGHG ADPRVADRIG 60 FYKRYCDVFR IGYGSGDLDC GGQRPFNAAV AVGDGLAAQ* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd00325 | chitinase_glyco_hydro_19 | 1.0e-23 | 1 | 80 | 80 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
pfam00182 | Glyco_hydro_19 | 8.0e-25 | 1 | 80 | 80 | + Chitinase class I. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAU10805.1 | 2e-37 | 1 | 99 | 1 | 95 | putative endochitinase [Oryza sativa Japonica Group] |
GenBank | EAY97965.1 | 8e-37 | 1 | 99 | 55 | 149 | hypothetical protein OsI_19883 [Oryza sativa Indica Group] |
RefSeq | NP_001150560.1 | 9.99995e-41 | 1 | 92 | 239 | 329 | LOC100284192 [Zea mays] |
RefSeq | XP_002441062.1 | 9.94922e-44 | 1 | 99 | 283 | 379 | hypothetical protein SORBIDRAFT_09g019660 [Sorghum bicolor] |
RefSeq | XP_002447824.1 | 1e-37 | 1 | 88 | 188 | 273 | hypothetical protein SORBIDRAFT_06g016510 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dyg_B | 6e-38 | 1 | 86 | 160 | 243 | A Chain A, Crystal Structures Of The Chromosomal Proteins Sso7dSAC7D Bound To Dna Containing T-G Mismatched Base Pairs |
PDB | 4dyg_A | 6e-38 | 1 | 86 | 160 | 243 | A Chain A, Crystal Structures Of The Chromosomal Proteins Sso7dSAC7D Bound To Dna Containing T-G Mismatched Base Pairs |
PDB | 4dwx_B | 6e-38 | 1 | 86 | 160 | 243 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
PDB | 4dwx_A | 6e-38 | 1 | 86 | 160 | 243 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
PDB | 1cns_B | 7e-37 | 1 | 86 | 159 | 242 | A Chain A, Crystal Structure Of Chitinase At 1.91a Resolution |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
chitin degradation II | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12623 | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12624 | EC-3.2.1.14 | chitinase |
chitin degradation III (carnivorous plants) | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL883898 | 100 | 1 | 100 | 0 |
FL883899 | 91 | 1 | 91 | 3.9937e-43 |
FL927367 | 100 | 1 | 100 | 1.00053e-42 |
BE597906 | 100 | 1 | 100 | 3e-38 |
CA267472 | 100 | 1 | 100 | 8e-38 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |