| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00033014m |
| Family | GH17 |
| Protein Properties | Length: 127 Molecular Weight: 12889 Isoelectric Point: 8.7348 |
| Chromosome | Chromosome/Scaffold: 0126414 Start: 2441 End: 3183 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 32 | 127 | 3.3e-35 |
| IGVNYGEVADNLPPPEETARLLKSTAISKVRLYGVDAGLIRALAGSNISVVVGVANGDIPSLAADPAAASRWLAANVLPFVPATAISAVAVGNEVL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 127 Download |
| MGAAARKRKP ASSLLPIWLL CLACAASAQP YIGVNYGEVA DNLPPPEETA RLLKSTAISK 60 VRLYGVDAGL IRALAGSNIS VVVGVANGDI PSLAADPAAA SRWLAANVLP FVPATAISAV 120 AVGNEVL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-24 | 32 | 126 | 95 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAF12778.2 | 0 | 1 | 127 | 1 | 124 | Os03g0669300 [Oryza sativa Japonica Group] |
| GenBank | EAY91326.1 | 0 | 15 | 127 | 12 | 124 | hypothetical protein OsI_12942 [Oryza sativa Indica Group] |
| RefSeq | NP_001050864.1 | 0 | 15 | 127 | 12 | 124 | Os03g0669300 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001148381.1 | 0 | 14 | 127 | 12 | 124 | glucan endo-1,3-beta-glucosidase 7 [Zea mays] |
| RefSeq | XP_002466692.1 | 0 | 17 | 127 | 20 | 132 | hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 6e-20 | 32 | 127 | 1 | 96 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3ur8_B | 2e-16 | 29 | 126 | 1 | 96 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3ur8_A | 2e-16 | 29 | 126 | 1 | 96 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3ur7_B | 2e-16 | 29 | 126 | 1 | 96 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 3ur7_A | 2e-16 | 29 | 126 | 1 | 96 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 28 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DN146505 | 127 | 1 | 127 | 0 |
| FL751077 | 127 | 1 | 127 | 0 |
| FL705180 | 127 | 1 | 127 | 0 |
| FL757341 | 127 | 1 | 127 | 0 |
| FL911118 | 127 | 1 | 127 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |