y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00033014m
FamilyGH17
Protein PropertiesLength: 127 Molecular Weight: 12889 Isoelectric Point: 8.7348
ChromosomeChromosome/Scaffold: 0126414 Start: 2441 End: 3183
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17321273.3e-35
  IGVNYGEVADNLPPPEETARLLKSTAISKVRLYGVDAGLIRALAGSNISVVVGVANGDIPSLAADPAAASRWLAANVLPFVPATAISAVAVGNEVL
Full Sequence
Protein Sequence     Length: 127     Download
MGAAARKRKP ASSLLPIWLL CLACAASAQP YIGVNYGEVA DNLPPPEETA RLLKSTAISK    60
VRLYGVDAGL IRALAGSNIS VVVGVANGDI PSLAADPAAA SRWLAANVLP FVPATAISAV    120
AVGNEVL                                                              180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_172.0e-243212695+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF12778.2011271124Os03g0669300 [Oryza sativa Japonica Group]
GenBankEAY91326.101512712124hypothetical protein OsI_12942 [Oryza sativa Indica Group]
RefSeqNP_001050864.101512712124Os03g0669300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148381.101412712124glucan endo-1,3-beta-glucosidase 7 [Zea mays]
RefSeqXP_002466692.101712720132hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A6e-2032127196A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_B2e-1629126196A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_A2e-1629126196A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur7_B2e-1629126196A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A2e-1629126196A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN14650512711270
FL75107712711270
FL70518012711270
FL75734112711270
FL91111812711270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00200.1
Brassica rapaBra019084.34.126Bra019084.34.126
Linum usitatissimumLus10011852
Malus domesticaMDP0000179206.29.173MDP0000179206.29.173
Panicum virgatumPavirv00044843m.49.143Pavirv00044843m.49.143
Picea abiesMA_23620g0010MA_228746g0010.15.193MA_2025g0010.29.211MA_10434774g0010MA_9313068g0010
MA_10434158g0010.39.166MA_10434158g0010.39.166
Vitis viniferaGSVIVT01030503001.24.113GSVIVT01030503001.24.113
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny