Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00034191m |
Family | AA2 |
Protein Properties | Length: 166 Molecular Weight: 18295.4 Isoelectric Point: 5.0704 |
Chromosome | Chromosome/Scaffold: 027471 Start: 3447 End: 7252 |
Description | stromal ascorbate peroxidase |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 2 | 153 | 1.2e-26 |
KYGRVDVTGPEQCPPEGKLPDAGPSSPADHLREVFYRMGLDDKDIVVLSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTAEWLKFDNSYFKEIK EKRDQDLLVLPTDAALFEDPAFKVYAEKYAADQDAFFKDYAEAHAKLSNLGA |
Full Sequence |
---|
Protein Sequence Length: 166 Download |
MKYGRVDVTG PEQCPPEGKL PDAGPSSPAD HLREVFYRMG LDDKDIVVLS GAHTLGRSRP 60 ERSGWGKPET KYTKNGPGAP GGQSWTAEWL KFDNSYFKEI KEKRDQDLLV LPTDAALFED 120 PAFKVYAEKY AADQDAFFKD YAEAHAKLSN LGAKFNPPQG ISLDD* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00693 | secretory_peroxidase | 1.0e-23 | 18 | 152 | 164 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
PLN02364 | PLN02364 | 2.0e-37 | 4 | 152 | 150 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 1.0e-40 | 4 | 152 | 149 | + L-ascorbate peroxidase | ||
PLN02608 | PLN02608 | 2.0e-55 | 14 | 158 | 145 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 6.0e-81 | 1 | 156 | 160 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAH67301.1 | 0 | 1 | 164 | 192 | 355 | OSIGBa0102D10.4 [Oryza sativa (indica cultivar-group)] |
GenBank | EEC77311.1 | 0 | 1 | 164 | 192 | 355 | hypothetical protein OsI_15969 [Oryza sativa Indica Group] |
RefSeq | NP_001052844.1 | 0 | 1 | 164 | 195 | 358 | Os04g0434800 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001132683.1 | 0 | 1 | 165 | 175 | 339 | hypothetical protein LOC100194161 [Zea mays] |
RefSeq | XP_002447862.1 | 0 | 1 | 165 | 180 | 344 | hypothetical protein SORBIDRAFT_06g017080 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1iyn_A | 0 | 1 | 164 | 111 | 274 | A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability |
PDB | 3zcy_A | 2e-36 | 15 | 152 | 125 | 245 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 3zch_A | 2e-36 | 15 | 152 | 137 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
PDB | 3zcg_A | 2e-36 | 15 | 152 | 137 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
PDB | 2wd4_A | 2e-36 | 15 | 152 | 137 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HO249158 | 166 | 1 | 166 | 0 |
HO276998 | 166 | 1 | 166 | 0 |
HO282996 | 166 | 1 | 166 | 0 |
GD047848 | 166 | 1 | 166 | 0 |
JG833031 | 166 | 1 | 166 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|