Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00034270m |
Family | GH16 |
Protein Properties | Length: 199 Molecular Weight: 21997.5 Isoelectric Point: 6.505 |
Chromosome | Chromosome/Scaffold: 0326560 Start: 616 End: 1212 |
Description | xyloglucan endotransglycosylase 6 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH16 | 2 | 124 | 1e-22 |
AFLQLSSQGSQHDEIDFEFLGNASGKPYTVHTNVYTQGKGGREQQFRVWFDPTADFHTYSVVWNPSHIVFYVDGVPIRDFRARAAAAAGVPFPASQPMRV YASVWDAEEWATQGGRVRTDWSR |
Full Sequence |
---|
Protein Sequence Length: 199 Download |
MAFLQLSSQG SQHDEIDFEF LGNASGKPYT VHTNVYTQGK GGREQQFRVW FDPTADFHTY 60 SVVWNPSHIV FYVDGVPIRD FRARAAAAAG VPFPASQPMR VYASVWDAEE WATQGGRVRT 120 DWSRAPFVAS YRGFGAAGCT SPDAAACARS NGAWMFQELD AAGQEQLRRA QATYMIYDYC 180 ADKYRFPQGP PPECAAPK* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd02175 | GH16_lichenase | 1.0e-17 | 10 | 112 | 106 | + lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure. |
cd02183 | GH16_fungal_CRH1_transglycosylase | 3.0e-20 | 14 | 132 | 133 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. |
pfam00722 | Glyco_hydro_16 | 5.0e-54 | 2 | 124 | 124 | + Glycosyl hydrolases family 16. |
PLN03161 | PLN03161 | 1.0e-78 | 6 | 198 | 201 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional |
cd02176 | GH16_XET | 3.0e-108 | 2 | 194 | 199 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005618 | cell wall |
GO:0005975 | carbohydrate metabolic process |
GO:0006073 | cellular glucan metabolic process |
GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABY79073.1 | 0 | 1 | 196 | 90 | 284 | xyloglucan xyloglucosyl transferase [Hordeum vulgare] |
GenBank | EAZ02222.1 | 0 | 1 | 196 | 92 | 287 | hypothetical protein OsI_24317 [Oryza sativa Indica Group] |
RefSeq | NP_001058457.1 | 0 | 1 | 196 | 92 | 287 | Os06g0696600 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001105367.1 | 0 | 1 | 197 | 84 | 278 | xyloglucan endotransglycosylase homolog1 [Zea mays] |
RefSeq | XP_002438935.1 | 0 | 6 | 197 | 97 | 286 | hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1un1_B | 0 | 6 | 194 | 82 | 272 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 1un1_A | 0 | 6 | 194 | 82 | 272 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 1umz_B | 0 | 6 | 194 | 82 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 1umz_A | 0 | 6 | 194 | 82 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 2vh9_B | 0 | 12 | 194 | 115 | 290 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HO157185 | 199 | 1 | 199 | 0 |
BG605826 | 178 | 20 | 197 | 0 |
HX154625 | 195 | 1 | 195 | 0 |
HX145994 | 195 | 1 | 195 | 0 |
HX154692 | 195 | 1 | 195 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|