y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00034981m
FamilyGH17
Protein PropertiesLength: 361 Molecular Weight: 37961.4 Isoelectric Point: 12.2173
ChromosomeChromosome/Scaffold: 032615 Start: 1895 End: 3367
Descriptionbeta-1,3-glucanase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17311712.10195e-44
  IGVCYGVNGGGLPSAGDVVRLYQSNGINLMRIYFPDADALRALSGSNIGLIMDVPNENLGSIASDPNAAAAWVRDNVQAFPAVSFRYIAVGNEVAGGDTA
  SILPAMRNIDAALADAGLGAVKVSTAVQSGSRRGSRRRPAA
Full Sequence
Protein Sequence     Length: 361     Download
MAKQQGVVAS MVALALLLGT FAAIPTGVQS IGVCYGVNGG GLPSAGDVVR LYQSNGINLM    60
RIYFPDADAL RALSGSNIGL IMDVPNENLG SIASDPNAAA AWVRDNVQAF PAVSFRYIAV    120
GNEVAGGDTA SILPAMRNID AALADAGLGA VKVSTAVQSG SRRGSRRRPA ASRRATWAPS    180
RSTCRAPARR SSQTSTPTSP TSATRPRSTS TTRSSPPPAP SCRTAATPTR TSSTRSSTPS    240
TPRSRTPARG TSASSCRRAA GRRRGATRPP RPTRRPTTRT SSTMSGRARP SAPGPSRPTY    300
SPCSTRTGSP EQRRRSTSDC STRTNRRHTP SVSEPTDFIQ EQDIHTDIHT HRNNEIVLQI    360
*                                                                    420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_178.0e-4331157130+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB04443.1051644164pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
GenBankABB04449.1051644164truncated pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
GenBankABB04452.1051644164pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
GenBankACJ62646.1051644164beta 1,3 glucanase [Zea mays subsp. parviglumis]
GenBankACJ62691.1051644164beta 1,3 glucanase [Zea mays subsp. parviglumis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghs_B3e-37311571128A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A3e-37311571128A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghr_A5e-35311571127A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aq0_B5e-35311571127A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A5e-35311571127A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL80711215811580
FE59852915811580
FE63601915511550
FE633082140191580
BE600966140191580
Orthologous Group
SpeciesID
Arabidopsis lyrata326432.33.170326432.33.170910092
Brassica rapaBra014643Bra014639
Carica papayaevm.model.supercontig_49.128.28.175evm.model.supercontig_49.128.28.175evm.model.supercontig_49.126
Citrus sinensisorange1.1g038030morange1.1g046781morange1.1g046740m
Fragaria vescamrna21954.1-v1.0-hybrid.12.119mrna21954.1-v1.0-hybrid.12.119mrna05671.1-v1.0-hybrid.102.226mrna05671.1-v1.0-hybrid.102.226
Glycine maxGlyma11g10061.1.17.94Glyma11g10061.1.17.94Glyma03g28841.1
Gossypium raimondiiGorai.008G159300.2.29.126Gorai.008G159300.2.29.126Gorai.010G003400.1.49.154Gorai.010G003400.1.49.154
Malus domesticaMDP0000609149.30.144MDP0000247130.167.242MDP0000247130.167.242MDP0000577118MDP0000275579
MDP0000281216MDP0000609149.30.144
Manihot esculentacassava4.1_023209m
Medicago truncatulaMedtr2g034440.2.22.152Medtr2g034440.2.22.152
Picea abiesMA_1006327g0010MA_837697g0010MA_6944718g0010MA_10383303g0010MA_219456g0010.27.188
MA_9530584g0020MA_688105g0010MA_219456g0010.27.188MA_100289g0010MA_10429961g0010
MA_10435462g0010MA_4654636g0010MA_207447g0010MA_10309446g0010
Populus trichocarpaPotri.016G042800.1
Prunus persicappa022480m
Ricinus communis30147.m013731.287.42730147.m013731.287.427
Thellungiella halophilaThhalv10015274m
Vitis viniferaGSVIVT01031544001.30.128GSVIVT01031543001.30.126GSVIVT01031543001.30.126GSVIVT01033543001GSVIVT01033540001
GSVIVT01031542001.43.122GSVIVT01031542001.43.122GSVIVT01031544001.30.128
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny