CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00038026m
FamilyGH35
Protein PropertiesLength: 839 Molecular Weight: 93915.9 Isoelectric Point: 7.124
ChromosomeChromosome/Scaffold: 000505 Start: 1257 End: 7160
Descriptionglycosyl hydrolase family 35 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35443470
  LMIDGKRDLFFSGAVHYPRSPPELWPKLIQRAKEGGLNTIETYVFWNAHEPEKGKYNFEGRLDLIKYLKVIQDHDMYAVVRIGPFIQAEWNHGGLPYWLR
  EIDRIIFRANNDAYKKEMERFVRFIVQKLKDAELFASQGGPIILTQIENEYGNIKKDHKIDGDKYLEWAAQMALSTQTGVPWVMCKQSSAPGEVIPTCNG
  RHCGDTWTLRDKDKPMLWTENWTAQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSMVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMCKEPKFGHLR
  DLHN
Full Sequence
Protein Sequence     Length: 839     Download
MTAVRAAAVL VAAAALAILL PGWAAAAWTL TKKGTIVTYD ARSLMIDGKR DLFFSGAVHY    60
PRSPPELWPK LIQRAKEGGL NTIETYVFWN AHEPEKGKYN FEGRLDLIKY LKVIQDHDMY    120
AVVRIGPFIQ AEWNHGGLPY WLREIDRIIF RANNDAYKKE MERFVRFIVQ KLKDAELFAS    180
QGGPIILTQI ENEYGNIKKD HKIDGDKYLE WAAQMALSTQ TGVPWVMCKQ SSAPGEVIPT    240
CNGRHCGDTW TLRDKDKPML WTENWTAQFR AYGDQVAMRS AEDIAYAVLR FFAKGGSMVN    300
YYMYHGGTNF GRTGASYVLT GYYDEAPMDE YGMCKEPKFG HLRDLHNVIR SYQKAFLTGE    360
HSSEMLGHGY EAHTFELPED KLCLSFLSNN NTGEDGTVIF RGEKHYVPSR SVSILVGCKN    420
VVYNTKRVFV QHSERSFHTS EVTSKNNLWE MFSEAIPKYH TTKIRAKEPL EQYNQTKDAT    480
DYLWYTTSFR LESDDLPFRG DIRPVLQVRS SAHSMIGFAN DAFVGSGRGS KQVKGFMFER    540
PVDLKVGVNH ITLLSTAMGM KDSGGELAEV KGGIQECLIQ GLNTGTLDLQ VNGWGHKAAL    600
DGEDKEIYSE KGVGKVQWKP AQNDMPTTWY KRYFDEPDGD DIVVLDMSSM SKGMIFVNGE    660
GMGRYWVSYK TLAGTPSQAL YHIPRPFLKP KDNLLVVFEE ELGKPGGILI QTVTRDDICV    720
LLSEHNPAQI KTWDTDGDKI KLIAEDHNTR GTLTCPPKKT IQEVVFASFG NPEGMCGNFT    780
VGTCHTPNAK QVVEKECLGK PSCVLPVSHT VYGADINCQS TTATLGVQVR CGSEKKGA*     840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_421.0e-764195150+
pfam02140Gal_Lectin2.0e-1875383182+
COG1874LacA1.0e-2137214189+
pfam01301Glyco_hydro_351.0e-13443349322+
PLN03059PLN03059037831822+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAG30724.102683124825putative beta-galactosidase precursor [Hordeum vulgare]
GenBankEEC84965.102883127799hypothetical protein OsI_32205 [Oryza sativa Indica Group]
GenBankEEE70132.102883127830hypothetical protein OsJ_30164 [Oryza sativa Japonica Group]
Swiss-ProtQ0IZZ802883327832BGL12_ORYSJ RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: Precursor
RefSeqXP_002460584.102983828803hypothetical protein SORBIDRAFT_02g031260 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A7.00649e-434334514325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B1e-364631112284A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B0.0003545701437572A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A1e-364631112284A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160703377140
DT9423822762425170
FL8292382444486910
FL8142912303705990
FL814291255976210.000005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)