| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00039603m |
| Family | GH77 |
| Protein Properties | Length: 137 Molecular Weight: 15199.2 Isoelectric Point: 5.562 |
| Chromosome | Chromosome/Scaffold: 053961 Start: 32 End: 1149 |
| Description | disproportionating enzyme |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH77 | 1 | 127 | 6.10001e-40 |
| MAVLQFAFGGGSDNPHLLHNHEMDQVVYTGTHDNDTVLGWWQNLPEEEKQIVIKYLPEAKNTDISWTLITAALSSVARTSMVTMQDILGLDSSGRMNTPA TQKGNWRWRIPSSVGFDSLSPEAAKLK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 137 Download |
| MAVLQFAFGG GSDNPHLLHN HEMDQVVYTG THDNDTVLGW WQNLPEEEKQ IVIKYLPEAK 60 NTDISWTLIT AALSSVARTS MVTMQDILGL DSSGRMNTPA TQKGNWRWRI PSSVGFDSLS 120 PEAAKLKELL ALYNRL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR00217 | malQ | 3.0e-26 | 1 | 120 | 122 | + 4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| COG1640 | MalQ | 1.0e-26 | 1 | 121 | 132 | + 4-alpha-glucanotransferase [Carbohydrate transport and metabolism] | ||
| pfam02446 | Glyco_hydro_77 | 2.0e-36 | 1 | 118 | 128 | + 4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan. | ||
| PRK14508 | PRK14508 | 2.0e-54 | 1 | 120 | 120 | + 4-alpha-glucanotransferase; Provisional | ||
| PLN02635 | PLN02635 | 2.0e-83 | 1 | 136 | 136 | + disproportionating enzyme | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004134 | 4-alpha-glucanotransferase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN26217.1 | 0 | 1 | 135 | 453 | 587 | unknown [Zea mays] |
| DDBJ | BAF22256.2 | 0 | 7 | 136 | 4 | 133 | Os07g0627000 [Oryza sativa Japonica Group] |
| GenBank | EEC82491.1 | 0 | 1 | 136 | 420 | 555 | hypothetical protein OsI_26949 [Oryza sativa Indica Group] |
| GenBank | EEE67630.1 | 0 | 1 | 136 | 420 | 555 | hypothetical protein OsJ_25204 [Oryza sativa Japonica Group] |
| RefSeq | XP_002461064.1 | 0 | 1 | 135 | 455 | 589 | hypothetical protein SORBIDRAFT_02g040000 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1x1n_A | 0 | 1 | 136 | 389 | 524 | A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato |
| PDB | 1esw_A | 5e-26 | 1 | 136 | 361 | 500 | A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato |
| PDB | 1cwy_A | 5e-26 | 1 | 136 | 361 | 500 | A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans |
| PDB | 1fp9_A | 5e-26 | 1 | 136 | 361 | 500 | A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans |
| PDB | 1fp8_A | 5e-26 | 1 | 136 | 361 | 500 | A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| starch degradation I | RXN-1828 | EC-2.4.1.25 | 4-α-glucanotransferase |
| starch degradation II | RXN-12391 | EC-2.4.1.25 | 4-α-glucanotransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FL728791 | 137 | 1 | 137 | 0 |
| FL976423 | 137 | 1 | 137 | 0 |
| JG878475 | 137 | 1 | 137 | 0 |
| JG944229 | 137 | 1 | 137 | 0 |
| FL890207 | 137 | 1 | 137 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
