CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00040033m
FamilyGT30
Protein PropertiesLength: 448 Molecular Weight: 49033.6 Isoelectric Point: 9.5113
ChromosomeChromosome/Scaffold: 057034 Start: 438 End: 3935
DescriptionKDO transferase A
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT30472280
  RWPERLGQPSAARPRPGSPLVWFHAVSLGEGMAALPVVRHCAGLHPGLPVLLTTTTLSSFEVIKDLLPDGVIYQFAPLDCPDAIDSFIGYWKPSLVLLME
  SELWPNLIMSAAAKGIAVALLNARMSLKSFNRWSVPLGLPLVTLMLSKLSLVAPLSTIQAVRFQLLHTPPGIIHFAGDLKYA
Full Sequence
Protein Sequence     Length: 448     Download
MRPARAPAPA AARGGLALYE LYRAASRAAA PAVLLWRRLQ GLEHPTRWPE RLGQPSAARP    60
RPGSPLVWFH AVSLGEGMAA LPVVRHCAGL HPGLPVLLTT TTLSSFEVIK DLLPDGVIYQ    120
FAPLDCPDAI DSFIGYWKPS LVLLMESELW PNLIMSAAAK GIAVALLNAR MSLKSFNRWS    180
VPLGLPLVTL MLSKLSLVAP LSTIQAVRFQ LLHTPPGIIH FAGDLKYAVG DVNVMENEVN    240
KINDLRQQFS NRPLWMAASI HRGEEQVILR VHEELIKIYP TLLLILVPRH PQDCKTFSLA    300
LKKQEVNFVL RSTKEVVSSG TRVYMVDTLG ELRMLYRVTP VAVIGGSFLP GLAGHNISEA    360
AAAGCAVVTG PHVGHFYHML LDMWQINPSA VKQVAGEFKL LQTLKELLGD AETLGACQRA    420
AKDAFSIMSH GVVNRVWNLV CRFAIDF* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04413Glycos_transf_N4.0e-5644229186+
COG1519KdtA2.0e-9836440410+
PRK05749PRK057497.0e-10736443409+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0016740transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN31913.1014461442unknown [Zea mays]
GenBankEEC71834.1014451444hypothetical protein OsI_04493 [Oryza sativa Indica Group]
RefSeqXP_002322900.10124405433predicted protein [Populus trichocarpa]
RefSeqXP_002458792.1014471446hypothetical protein SORBIDRAFT_03g040370 [Sorghum bicolor]
RefSeqXP_002528642.10843834333-deoxy-d-manno-octulosonic-acid transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2xcu_D2e-236742043356A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB2xcu_C2e-236742043356A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB2xcu_B2e-236742043356A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB2xcu_A2e-236742043356A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB2xci_D2e-236742043356A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
Metabolic Pathways
Pathway NameReactionECProtein Name
KDO transfer to lipid IVA IKDOTRANS-RXNEC-2.4.99.12lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
KDO transfer to lipid IVA IKDOTRANS2-RXNEC-2.4.99.13(KDO)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB675948250362850
DV5033462292184460
FE6165212171383530
DY279419319363540
FE616521253543782.5
Orthologous Group
SpeciesID
Arabidopsis lyrata325028
Arabidopsis thalianaAT5G03770.1
Brachypodium distachyonBradi2g55417.1
Brassica rapaBra009511
Carica papayaevm.model.supercontig_5.99
Capsella rubellaCarubv10000940m
Chlamydomonas reinhardtiiCre13.g583100.t1.3
Citrus clementinaCiclev10032390mCiclev10032645m
Cucumis sativusCucsa.039090.1
Eucalyptus grandisEucgr.A01566.1
Fragaria vescamrna30104.1-v1.0-hybrid
Glycine maxGlyma10g07520.1
Gossypium raimondiiGorai.009G409200.3Gorai.009G409200.4Gorai.009G409200.2Gorai.009G409200.1
Linum usitatissimumLus10033622Lus10017663
Malus domesticaMDP0000133066
Manihot esculentacassava4.1_023442mcassava4.1_007754m
Medicago truncatulaMedtr1g061560.1
Mimulus guttatusmgv1a006467m
Oryza sativaLOC_Os01g63840.2LOC_Os01g63840.1
Panicum virgatumPavirv00069505m
Physcomitrella patensPp1s441_14V6.1
Phaseolus vulgarisPhvul.007G224100.1
Picea abiesMA_159008g0430
Populus trichocarpaPotri.016G095900.3Potri.016G095900.6Potri.016G095900.1Potri.016G095900.5Potri.016G095900.2
Potri.016G095900.4
Prunus persicappa025343m
Ricinus communis29815.m000507
Setaria italicaSi001596m
Selaginella moellendorffii76719
Sorghum bicolorSb03g040370.1
Thellungiella halophilaThhalv10013569m
Vitis viniferaGSVIVT01033751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny