Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00040284m |
Family | CBM43 |
Protein Properties | Length: 137 Molecular Weight: 14525.3 Isoelectric Point: 4.556 |
Chromosome | Chromosome/Scaffold: 054257 Start: 1 End: 653 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 51 | 134 | 4.8e-33 |
WCVPKPGADEMMLQENIDFACGQEGVDCAAIRAGGVCYEPDTLQGHAAYAMNLYFQSNGQHAFDCDFGQTGLVTTADPSYGGCK |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
NLKPGPVSQR NFGLFRGDMT AVYDAGIFTS PETVVPVSTK VTPAAAGRRQ WCVPKPGADE 60 MMLQENIDFA CGQEGVDCAA IRAGGVCYEP DTLQGHAAYA MNLYFQSNGQ HAFDCDFGQT 120 GLVTTADPSY GGCKFM* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-21 | 50 | 121 | 81 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-41 | 50 | 135 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAH92875.1 | 0 | 1 | 135 | 17 | 157 | Os04g0681950 [Oryza sativa Japonica Group] |
GenBank | EEC78268.1 | 0 | 1 | 135 | 771 | 911 | hypothetical protein OsI_17962 [Oryza sativa Indica Group] |
GenBank | EEE61922.1 | 0 | 1 | 135 | 751 | 891 | hypothetical protein OsJ_16662 [Oryza sativa Japonica Group] |
RefSeq | NP_001151529.1 | 0 | 1 | 136 | 320 | 450 | LOC100285163 [Zea mays] |
RefSeq | XP_002448791.1 | 0 | 1 | 136 | 323 | 464 | hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-31 | 42 | 135 | 6 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CA103690 | 143 | 1 | 137 | 0 |
DR796896 | 135 | 3 | 137 | 0 |
EB404450 | 133 | 5 | 137 | 0 |
FL454454 | 126 | 12 | 137 | 0 |
CI276177 | 145 | 1 | 137 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|