Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00041882m |
Family | GT5 |
Protein Properties | Length: 125 Molecular Weight: 14243.1 Isoelectric Point: 4.5409 |
Chromosome | Chromosome/Scaffold: 0165966 Start: 509 End: 2569 |
Description | starch synthase 4 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT5 | 2 | 114 | 0 |
IFAASDMFIVPSMFEPCGLTQMIAMRYGSVPVVRRTGGLNDSVFDFDDETIPMELRNGFTFLKADEQGFDSALERAFNYYHRKPEVWKQLVQKDMKIDFS WDTSASQYEDIYQ |
Full Sequence |
---|
Protein Sequence Length: 125 Download |
MIFAASDMFI VPSMFEPCGL TQMIAMRYGS VPVVRRTGGL NDSVFDFDDE TIPMELRNGF 60 TFLKADEQGF DSALERAFNY YHRKPEVWKQ LVQKDMKIDF SWDTSASQYE DIYQRAAAQA 120 RAAT* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG0297 | GlgA | 1.0e-46 | 1 | 113 | 113 | + Glycogen synthase [Carbohydrate transport and metabolism] |
cd03791 | GT1_Glycogen_synthase_DULL1_like | 2.0e-54 | 1 | 113 | 113 | + This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms. |
PRK00654 | glgA | 1.0e-54 | 1 | 113 | 113 | + glycogen synthase; Provisional |
TIGR02095 | glgA | 2.0e-58 | 1 | 113 | 113 | + glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate [Energy metabolism, Biosynthesis and degradation of polysaccharides]. |
PLN02939 | PLN02939 | 4.0e-82 | 1 | 113 | 113 | + transferase, transferring glycosyl groups |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAK97773.1 | 0 | 2 | 115 | 792 | 905 | starch synthase isoform IV [Triticum aestivum] |
GenBank | ABD64538.1 | 0 | 2 | 115 | 792 | 905 | starch synthase IV [Triticum aestivum] |
EMBL | CAX51362.1 | 0 | 2 | 115 | 273 | 386 | soluble starch synthase [Hordeum vulgare subsp. vulgare] |
RefSeq | NP_001123590.1 | 0 | 1 | 115 | 786 | 900 | starch synthase IV [Zea mays] |
RefSeq | XP_002440128.1 | 0 | 1 | 114 | 786 | 899 | hypothetical protein SORBIDRAFT_09g026570 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1rzv_B | 4e-26 | 4 | 115 | 364 | 474 | A Chain A, Crystal Structure Of The Glycogen Synthase From Agrobacterium Tumefaciens (Non-Complexed Form) |
PDB | 1rzv_A | 4e-26 | 4 | 115 | 364 | 474 | A Chain A, Crystal Structure Of The Glycogen Synthase From Agrobacterium Tumefaciens (Non-Complexed Form) |
PDB | 1rzu_B | 4e-26 | 4 | 115 | 364 | 474 | A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp |
PDB | 1rzu_A | 4e-26 | 4 | 115 | 364 | 474 | A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp |
PDB | 3d1j_A | 2e-25 | 2 | 115 | 363 | 475 | A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
starch biosynthesis | GLYCOGENSYN-RXN | EC-2.4.1.21 | starch synthase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JK580486 | 113 | 1 | 113 | 0 |
HO342836 | 113 | 1 | 113 | 0 |
JK568719 | 113 | 1 | 113 | 0 |
DN151674 | 113 | 1 | 113 | 0 |
JG904878 | 113 | 1 | 113 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |