CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00042421m
FamilyGH51
Protein PropertiesLength: 496 Molecular Weight: 54363.4 Isoelectric Point: 4.6956
ChromosomeChromosome/Scaffold: 016959 Start: 2720 End: 8824
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512274920
  IWFDQVSLMPSDTFMGHGFRKDLAYMLANLKPRFLKFPGGNYVMGNYLVNAFRWSETVGPWEERPGHFNDAWAYWTDDGLGFFEFLQLAEDLGACPFWVV
  NDGASLNEEVPTATIAAFVKDVVNGIEFARGDPQTAWGSVRAAMGHPEPFQLYYVSIGNQECSKYYYKDNYMKFYSAIKASYPDITIISSCDRSAVSPVN
  PADLYDVHVYTSSGDMFSRSRMFDNTARSGPKAIVSEYAVTGNDAGRGTLIAALAEAAFLIGLERN
Full Sequence
Protein Sequence     Length: 496     Download
MGVLRAGSVC WLFHVLVLVC ALCQILYVGS VGAQTAQLSV DASPQNAQVI PGNMFGIFFE    60
EINHAGAGGL WAELVSNRGF EAGGPNTPSN IDPWLIIGDE SNIIVATDRS SCFAGNPIAL    120
RMEVHCETTG TNACPSGGVG IYNPGYWGMN IERRKVYRAT MYIKSSESVE LTVSLTSSDG    180
LQILASHTIT GDKEDFVEWT KVEFDLESIG RNTNSRLQLT TTKSGIIWFD QVSLMPSDTF    240
MGHGFRKDLA YMLANLKPRF LKFPGGNYVM GNYLVNAFRW SETVGPWEER PGHFNDAWAY    300
WTDDGLGFFE FLQLAEDLGA CPFWVVNDGA SLNEEVPTAT IAAFVKDVVN GIEFARGDPQ    360
TAWGSVRAAM GHPEPFQLYY VSIGNQECSK YYYKDNYMKF YSAIKASYPD ITIISSCDRS    420
AVSPVNPADL YDVHVYTSSG DMFSRSRMFD NTARSGPKAI VSEYAVTGND AGRGTLIAAL    480
AEAAFLIGLE RNRFC* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA1.0e-26244386143+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF95656.1014921492Alpha-L-arabinofuranosidase C-terminus family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABF95657.1014931493Alpha-L-arabinofuranosidase C-terminus family protein, expressed [Oryza sativa (japonica cultivar-group)]
DDBJBAC10349.1014921491putative arabinoxylan narabinofuranohydrolase isoenzyme AXAH-I [Oryza sativa Japonica Group]
GenBankEEC75141.1014921496hypothetical protein OsI_11337 [Oryza sativa Indica Group]
GenBankEEE58961.1014921496hypothetical protein OsJ_10647 [Oryza sativa Japonica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ug5_F0.0000000000000124444468265A Chain A, Crystal Structure Of A Putative Metallopeptidase (Sama_0725) From Shewanella Amazonensis Sb2b At 2.00 A Resolution
PDB3ug5_E0.0000000000000124444468265A Chain A, Crystal Structure Of A Putative Metallopeptidase (Sama_0725) From Shewanella Amazonensis Sb2b At 2.00 A Resolution
PDB3ug5_D0.0000000000000124444468265A Chain A, Crystal Structure Of A Putative Metallopeptidase (Sama_0725) From Shewanella Amazonensis Sb2b At 2.00 A Resolution
PDB3ug5_C0.0000000000000124444468265A Chain A, Crystal Structure Of A Putative Metallopeptidase (Sama_0725) From Shewanella Amazonensis Sb2b At 2.00 A Resolution
PDB3ug5_B0.0000000000000124444468265A Chain A, Crystal Structure Of A Putative Metallopeptidase (Sama_0725) From Shewanella Amazonensis Sb2b At 2.00 A Resolution
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
33
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0500553301464750
GO87230233513350
FL9149062651944580
GO83804731813180
FL914906374284640.36
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)