CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00042978m
FamilyGT28
Protein PropertiesLength: 502 Molecular Weight: 55492 Isoelectric Point: 7.4996
ChromosomeChromosome/Scaffold: 016761 Start: 5151 End: 8824
Descriptionmonogalactosyldiacylglycerol synthase 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT283014591.1e-31
  VLLMGGGEGMGPVKKTAKALGESLFDKEQGKPIGQLIVICGRNKTLSSSLQALEWKIPVKIRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN
  DFIPGQEVGNVPYVVDNGAGVFSKSPKEIASLVARWFGPDSEELKKMSENALKLAQPEA
Full Sequence
Protein Sequence     Length: 502     Download
MAASMASPRG RSIRETVLET VAAYHNQQRM RRKLRKSLTY AGELSSAGRP RGDGASSSAS    60
VSSLCGAEDD DEPFWEEEEG TVELVQLGAN RAKNVLILMS DTGGGHRASA EAIKDAFRIE    120
FGDEYRVFVK DLCKDHAGWP LNNMESSYKF MVKHVQLWKV AFHSTSPRWV HCFYLAALAS    180
FYAKKVEAGL KKYKPDIIIS VHPLMQHIPL WVLKWQGLQN RVVFVTVITD LNTCHPTWFH    240
ANVNRCYCPS EEVAKRAALD DLQPSQIRVF GLPIRPSFCR AVLVKDELMK ELELDPELPA    300
VLLMGGGEGM GPVKKTAKAL GESLFDKEQG KPIGQLIVIC GRNKTLSSSL QALEWKIPVK    360
IRGFETQMEK WMGACDCIIT KAGPGTIAEA LIRGLPIILN DFIPGQEVGN VPYVVDNGAG    420
VFSKSPKEIA SLVARWFGPD SEELKKMSEN ALKLAQPEAV FDIVRDIHEL SREQGVMSQI    480
SSSLTSSFFI SSPETTPLQL I* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG2.0e-2896473394+
PRK13608PRK136082.0e-3793470394+
PRK13609PRK136093.0e-4790471395+
pfam06925MGDG_synth1.0e-71106274169+
PLN02605PLN02605095474382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC77638.101445011358putative monogalactosyldiacylglycerol synthase [Oryza sativa Indica Group]
GenBankEAY87902.10849914506hypothetical protein OsI_09321 [Oryza sativa Indica Group]
RefSeqNP_001147778.1015011501LOC100281388 [Zea mays]
Swiss-ProtQ0DWQ10850114508MGDG3_ORYSJ RecName: Full=Probable monogalactosyldiacylglycerol synthase 3, chloroplastic; Short=OsMGD3; Flags: Precursor
RefSeqXP_002452992.1015011501hypothetical protein SORBIDRAFT_04g036240 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8450523121905010
DR796907270973660
DT3392792961534480
CJ6720792751314050
FL7596132511544040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899mPavirv00008414m
Pavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)