Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00042983m |
Family | CBM43 |
Protein Properties | Length: 107 Molecular Weight: 11121.5 Isoelectric Point: 7.9251 |
Chromosome | Chromosome/Scaffold: 016675 Start: 5024 End: 5580 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 77 | 7.7e-28 |
PGASQEDLQNALDWACGPGGADCSQLQPGGRCYQPNTLLTHASYAFNIFYQQNGNSDIACNFGSAGGLVKRDPRM |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
NRPGASQEDL QNALDWACGP GGADCSQLQP GGRCYQPNTL LTHASYAFNI FYQQNGNSDI 60 ACNFGSAGGL VKRDPRMTSA AASSAMLGRA WTAMVAASLI ALRLIV* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-17 | 2 | 68 | 72 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-30 | 2 | 75 | 74 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EAZ02781.1 | 1.4013e-45 | 2 | 106 | 60 | 172 | hypothetical protein OsI_24906 [Oryza sativa Indica Group] |
GenBank | EAZ38703.1 | 2.94273e-44 | 2 | 106 | 13 | 125 | hypothetical protein OsJ_23103 [Oryza sativa Japonica Group] |
RefSeq | NP_001058896.1 | 1.4013e-45 | 2 | 106 | 13 | 125 | Os07g0149900 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001144702.1 | 0 | 2 | 102 | 62 | 173 | hypothetical protein LOC100277738 [Zea mays] |
RefSeq | XP_002461458.1 | 0 | 2 | 106 | 61 | 176 | hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000005 | 2 | 75 | 17 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL748820 | 116 | 2 | 107 | 0 |
HO272805 | 113 | 5 | 107 | 0 |
HO272804 | 113 | 5 | 107 | 0 |
CA141830 | 116 | 2 | 107 | 0 |
CA092832 | 116 | 2 | 107 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|