| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00043672m |
| Family | CE8 |
| Protein Properties | Length: 85 Molecular Weight: 8949.93 Isoelectric Point: 3.8652 |
| Chromosome | Chromosome/Scaffold: 0308700 Start: 10 End: 514 |
| Description | Plant invertase/pectin methylesterase inhibitor superfamily |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 1 | 69 | 6.3e-21 |
| MQSELDSLIDPAGWLEWSGDFALDTLYYGEYMNTGAGAGTSGRVKWKGYRVITSAAEASAFTVGSFIDG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 85 Download |
| MQSELDSLID PAGWLEWSGD FALDTLYYGE YMNTGAGAGT SGRVKWKGYR VITSAAEASA 60 FTVGSFIDGD VWLAGTSIPF TTGL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02933 | PLN02933 | 5.0e-35 | 1 | 84 | 84 | + Probable pectinesterase/pectinesterase inhibitor | ||
| PLN02916 | PLN02916 | 5.0e-35 | 1 | 84 | 84 | + pectinesterase family protein | ||
| PLN02713 | PLN02713 | 1.0e-36 | 1 | 84 | 84 | + Probable pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 2.0e-39 | 1 | 84 | 84 | + pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 5.0e-42 | 1 | 70 | 70 | + Pectinesterase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAN84553.1 | 1.96182e-44 | 1 | 84 | 143 | 226 | methyl pectinesterase [Lolium perenne] |
| GenBank | EEC70505.1 | 9.94922e-44 | 1 | 84 | 482 | 565 | hypothetical protein OsI_01594 [Oryza sativa Indica Group] |
| RefSeq | NP_001042866.1 | 4.06377e-44 | 1 | 84 | 343 | 426 | Os01g0312500 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001146685.1 | 0 | 1 | 84 | 480 | 563 | hypothetical protein LOC100280285 [Zea mays] |
| RefSeq | XP_002455538.1 | 0 | 1 | 84 | 493 | 576 | hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 2e-33 | 1 | 84 | 236 | 319 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 3e-28 | 1 | 84 | 232 | 315 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2102 | EC-3.1.1.11 | pectinesterase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FL727046 | 85 | 1 | 85 | 0 |
| FL939938 | 85 | 1 | 85 | 0 |
| DN149497 | 85 | 1 | 85 | 0 |
| DN148219 | 85 | 1 | 85 | 0 |
| FL743414 | 85 | 1 | 85 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |